© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|4831 |
| Gene name | |
| Location | Contig_2432:172..784 |
| Strand | - |
| Gene length (bp) | 612 |
| Transcript length (bp) | 441 |
| Coding sequence length (bp) | 441 |
| Protein length (aa) | 147 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00076 | RRM_1 | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | 4.4E-15 | 15 | 85 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q09442|SF3B4_CAEEL | Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 | 8 | 135 | 9.0E-47 |
| sp|O14102|SAP49_SCHPO | Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 | 8 | 135 | 4.0E-45 |
| sp|Q6AYL5|SF3B4_RAT | Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 | 1 | 135 | 7.0E-45 |
| sp|Q8QZY9|SF3B4_MOUSE | Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 | 1 | 135 | 7.0E-45 |
| sp|Q15427|SF3B4_HUMAN | Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 | 1 | 135 | 8.0E-45 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q09442|SF3B4_CAEEL | Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 | 8 | 135 | 9.0E-47 |
| sp|O14102|SAP49_SCHPO | Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 | 8 | 135 | 4.0E-45 |
| sp|Q6AYL5|SF3B4_RAT | Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 | 1 | 135 | 7.0E-45 |
| sp|Q8QZY9|SF3B4_MOUSE | Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 | 1 | 135 | 7.0E-45 |
| sp|Q15427|SF3B4_HUMAN | Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 | 1 | 135 | 8.0E-45 |
| sp|Q55GD6|SF3B4_DICDI | Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 | 1 | 135 | 1.0E-28 |
| sp|Q99181|HSH49_YEAST | Protein HSH49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH49 PE=1 SV=1 | 6 | 132 | 1.0E-19 |
| sp|Q5R8F7|PABP1_PONAB | Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 | 13 | 130 | 3.0E-19 |
| sp|P42731|PABP2_ARATH | Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 | 13 | 130 | 3.0E-19 |
| sp|Q6IP09|PABPB_XENLA | Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 | 13 | 130 | 9.0E-19 |
| sp|Q9EPH8|PABP1_RAT | Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 | 13 | 130 | 9.0E-19 |
| sp|P29341|PABP1_MOUSE | Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 | 13 | 130 | 1.0E-18 |
| sp|P11940|PABP1_HUMAN | Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 | 13 | 130 | 1.0E-18 |
| sp|P61286|PABP1_BOVIN | Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 | 13 | 130 | 1.0E-18 |
| sp|P20965|PABPA_XENLA | Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 | 13 | 130 | 1.0E-18 |
| sp|Q13310|PABP4_HUMAN | Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 | 13 | 130 | 2.0E-18 |
| sp|Q6GR16|EPABB_XENLA | Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 | 13 | 130 | 1.0E-17 |
| sp|Q6DEY7|EPAB_XENTR | Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 | 13 | 130 | 2.0E-17 |
| sp|Q0U1G2|PABP_PHANO | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 | 13 | 130 | 3.0E-17 |
| sp|Q4VXU2|PAP1L_HUMAN | Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 | 13 | 130 | 4.0E-17 |
| sp|Q98SP8|EPABA_XENLA | Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 | 13 | 130 | 7.0E-17 |
| sp|Q5JQF8|PAP1M_HUMAN | Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 | 13 | 130 | 2.0E-16 |
| sp|P31209|PABP_SCHPO | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 | 13 | 130 | 2.0E-16 |
| sp|Q9H361|PABP3_HUMAN | Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 | 13 | 130 | 3.0E-16 |
| sp|Q7S6N6|PABP_NEUCR | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 | 13 | 137 | 3.0E-16 |
| sp|Q2UK72|PABP_ASPOR | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 | 6 | 130 | 5.0E-16 |
| sp|A1CRM1|PABP_ASPCL | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 | 9 | 130 | 5.0E-16 |
| sp|A2Q848|PABP_ASPNC | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 | 9 | 130 | 5.0E-16 |
| sp|Q9FXA2|PABP8_ARATH | Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 | 9 | 130 | 5.0E-16 |
| sp|Q4WK03|PABP_ASPFU | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 | 9 | 130 | 6.0E-16 |
| sp|A1D4K4|PABP_NEOFI | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 | 9 | 130 | 7.0E-16 |
| sp|Q0CR95|PABP_ASPTN | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 | 9 | 130 | 8.0E-16 |
| sp|Q2GSX8|PABP_CHAGB | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 | 13 | 130 | 9.0E-16 |
| sp|A4QUF0|PABP_MAGO7 | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 | 13 | 130 | 1.0E-15 |
| sp|Q05196|PABP5_ARATH | Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 | 13 | 130 | 3.0E-15 |
| sp|Q1DXH0|PABP_COCIM | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 | 13 | 130 | 7.0E-15 |
| sp|P0CP46|PABP_CRYNJ | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 | 13 | 130 | 8.0E-15 |
| sp|P0CP47|PABP_CRYNB | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 | 13 | 130 | 8.0E-15 |
| sp|P21187|PABP_DROME | Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 | 13 | 130 | 8.0E-15 |
| sp|Q5B630|PABP_EMENI | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 | 9 | 130 | 1.0E-14 |
| sp|Q6CSV3|PABP_KLULA | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 | 9 | 130 | 3.0E-14 |
| sp|P60050|PABP5_PONPY | Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 | 17 | 130 | 3.0E-14 |
| sp|P60049|PABP5_PANTR | Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 | 17 | 130 | 3.0E-14 |
| sp|P60048|PABP5_HYLLA | Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 | 17 | 130 | 3.0E-14 |
| sp|Q96DU9|PABP5_HUMAN | Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 | 17 | 130 | 3.0E-14 |
| sp|P60047|PABP5_GORGO | Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 | 17 | 130 | 3.0E-14 |
| sp|Q7JGR2|PABP5_MACMU | Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 | 17 | 130 | 3.0E-14 |
| sp|Q6BI95|PABP_DEBHA | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 | 10 | 130 | 4.0E-14 |
| sp|Q6CDH3|PABP_YARLI | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 | 8 | 130 | 4.0E-14 |
| sp|Q4P8R9|PABP_USTMA | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 | 3 | 130 | 5.0E-14 |
| sp|P57052|RBM11_HUMAN | Splicing regulator RBM11 OS=Homo sapiens GN=RBM11 PE=1 SV=1 | 8 | 86 | 7.0E-14 |
| sp|Q80YT9|RBM11_MOUSE | Splicing regulator RBM11 OS=Mus musculus GN=Rbm11 PE=1 SV=1 | 8 | 86 | 8.0E-14 |
| sp|Q6FKG4|PABP_CANGA | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 | 13 | 129 | 2.0E-13 |
| sp|A3LXL0|PABP_PICST | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 | 10 | 130 | 3.0E-13 |
| sp|Q54BM2|PAP1A_DICDI | Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 | 12 | 130 | 4.0E-13 |
| sp|A5DW14|PABP_LODEL | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 | 10 | 130 | 5.0E-13 |
| sp|Q5AI15|PABP_CANAL | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 | 10 | 130 | 7.0E-13 |
| sp|O64380|PABP3_ARATH | Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 | 13 | 130 | 1.0E-12 |
| sp|Q9CQT2|RBM7_MOUSE | RNA-binding protein 7 OS=Mus musculus GN=Rbm7 PE=1 SV=1 | 14 | 130 | 3.0E-12 |
| sp|P04147|PABP_YEAST | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 | 9 | 129 | 5.0E-12 |
| sp|Q74ZS6|PABP_ASHGO | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 | 13 | 130 | 5.0E-12 |
| sp|A5DM21|PABP_PICGU | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 | 15 | 130 | 7.0E-12 |
| sp|P0CB38|PAB4L_HUMAN | Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 | 13 | 129 | 7.0E-12 |
| sp|O22173|PABP4_ARATH | Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 | 13 | 130 | 4.0E-11 |
| sp|Q1ZXC2|PAP1B_DICDI | Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 | 14 | 129 | 5.0E-11 |
| sp|Q9Y580|RBM7_HUMAN | RNA-binding protein 7 OS=Homo sapiens GN=RBM7 PE=1 SV=1 | 10 | 100 | 6.0E-11 |
| sp|Q3MHY8|RBM7_BOVIN | RNA-binding protein 7 OS=Bos taurus GN=RBM7 PE=2 SV=1 | 10 | 86 | 7.0E-11 |
| sp|Q60990|RBY1B_MOUSE | RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 | 8 | 89 | 1.0E-10 |
| sp|Q9WX37|RBPE_NOSS1 | Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 | 14 | 101 | 1.0E-10 |
| sp|Q9H361|PABP3_HUMAN | Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 | 15 | 130 | 2.0E-10 |
| sp|Q9SYG4|UBP1A_ARATH | Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 | 14 | 124 | 2.0E-10 |
| sp|P32588|PUB1_YEAST | Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 | 9 | 129 | 3.0E-10 |
| sp|F4HT49|PABP1_ARATH | Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 | 14 | 134 | 4.0E-10 |
| sp|Q8T6B9|PUF68_DROME | Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 | 15 | 128 | 4.0E-10 |
| sp|Q9LJH8|UBP1C_ARATH | Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 | 14 | 124 | 4.0E-10 |
| sp|Q57014|RBPA_SYNY3 | Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 | 14 | 89 | 4.0E-10 |
| sp|Q4G338|PPIE_HAECO | Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 | 6 | 89 | 6.0E-10 |
| sp|Q5R723|PPIE_PONAB | Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 | 14 | 89 | 7.0E-10 |
| sp|Q9UNP9|PPIE_HUMAN | Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 | 14 | 89 | 7.0E-10 |
| sp|A4FV72|PPIE_BOVIN | Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 | 14 | 89 | 7.0E-10 |
| sp|Q9QZH3|PPIE_MOUSE | Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 | 14 | 89 | 8.0E-10 |
| sp|Q5R8F7|PABP1_PONAB | Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 | 15 | 130 | 2.0E-09 |
| sp|P11940|PABP1_HUMAN | Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 | 15 | 130 | 2.0E-09 |
| sp|P61286|PABP1_BOVIN | Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 | 15 | 130 | 2.0E-09 |
| sp|Q44556|RBPD_NOSS1 | Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 | 14 | 89 | 2.0E-09 |
| sp|Q9V3G3|PPIE_DROME | Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 | 14 | 89 | 2.0E-09 |
| sp|Q7ZWA3|RBMX_DANRE | RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 | 8 | 90 | 4.0E-09 |
| sp|Q9EPH8|PABP1_RAT | Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 | 15 | 130 | 5.0E-09 |
| sp|Q9M427|UBP1_NICPL | Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 | 14 | 124 | 5.0E-09 |
| sp|P29341|PABP1_MOUSE | Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 | 15 | 130 | 6.0E-09 |
| sp|W8E7I1|RBM3_CAPHI | RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 | 11 | 101 | 6.0E-09 |
| sp|B1WC40|NCBP2_RAT | Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 | 11 | 87 | 8.0E-09 |
| sp|Q9CQ49|NCBP2_MOUSE | Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 | 11 | 87 | 8.0E-09 |
| sp|P52298|NCBP2_HUMAN | Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 | 11 | 87 | 8.0E-09 |
| sp|Q3ZBJ1|NCBP2_BOVIN | Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 | 11 | 87 | 8.0E-09 |
| sp|Q6IRQ4|RBMX_XENLA | RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 | 8 | 90 | 9.0E-09 |
| sp|A4QUF0|PABP_MAGO7 | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 | 13 | 140 | 1.0E-08 |
| sp|Q6FKG4|PABP_CANGA | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 | 13 | 129 | 1.0E-08 |
| sp|O35698|RBY1A_MOUSE | RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 | 8 | 89 | 1.0E-08 |
| sp|Q2HJG2|PUF60_BOVIN | Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 | 1 | 90 | 1.0E-08 |
| sp|Q5R469|PUF60_PONAB | Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 | 1 | 90 | 1.0E-08 |
| sp|Q28GD4|ELAV2_XENTR | ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 | 9 | 129 | 1.0E-08 |
| sp|Q9UHX1|PUF60_HUMAN | Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 | 1 | 90 | 1.0E-08 |
| sp|Q9WV25|PUF60_RAT | Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 | 1 | 90 | 1.0E-08 |
| sp|Q3UEB3|PUF60_MOUSE | Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 | 1 | 90 | 1.0E-08 |
| sp|Q5R9Z6|ELAV2_PONAB | ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 | 9 | 129 | 1.0E-08 |
| sp|Q12926|ELAV2_HUMAN | ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 | 9 | 129 | 1.0E-08 |
| sp|Q60899|ELAV2_MOUSE | ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 | 9 | 129 | 1.0E-08 |
| sp|Q5R1W5|SRSF2_PANTR | Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 | 13 | 89 | 2.0E-08 |
| sp|P30352|SRSF2_CHICK | Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 | 13 | 89 | 2.0E-08 |
| sp|Q9DED4|CIRBB_XENLA | Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 | 12 | 89 | 2.0E-08 |
| sp|Q06A98|SRSF2_PIG | Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 | 13 | 89 | 2.0E-08 |
| sp|Q6PDU1|SRSF2_RAT | Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 | 13 | 89 | 2.0E-08 |
| sp|Q62093|SRSF2_MOUSE | Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 | 13 | 89 | 2.0E-08 |
| sp|Q01130|SRSF2_HUMAN | Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 | 13 | 89 | 2.0E-08 |
| sp|Q3MHR5|SRSF2_BOVIN | Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 | 13 | 89 | 2.0E-08 |
| sp|P98179|RBM3_HUMAN | RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 | 11 | 89 | 2.0E-08 |
| sp|Q9LQI9|UBP1B_ARATH | Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 | 14 | 124 | 2.0E-08 |
| sp|Q925G0|RBM3_RAT | RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 | 11 | 101 | 3.0E-08 |
| sp|Q28FX0|ELAV3_XENTR | ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 | 35 | 129 | 3.0E-08 |
| sp|Q91584|ELAV3_XENLA | ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 | 35 | 129 | 3.0E-08 |
| sp|O89086|RBM3_MOUSE | RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 | 11 | 89 | 3.0E-08 |
| sp|Q61701|ELAV4_MOUSE | ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 | 35 | 129 | 3.0E-08 |
| sp|Q8CH84|ELAV2_RAT | ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 | 35 | 129 | 3.0E-08 |
| sp|P26378|ELAV4_HUMAN | ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 | 35 | 129 | 3.0E-08 |
| sp|Q02427|RBP1_DROME | RNA-binding protein 1 OS=Drosophila melanogaster GN=Rbp1 PE=2 SV=3 | 5 | 86 | 3.0E-08 |
| sp|O09032|ELAV4_RAT | ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 | 35 | 129 | 3.0E-08 |
| sp|Q6IQE0|PU60B_DANRE | Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 | 15 | 88 | 3.0E-08 |
| sp|Q44554|RBPB_NOSS1 | Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 | 14 | 89 | 3.0E-08 |
| sp|P20965|PABPA_XENLA | Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 | 15 | 130 | 4.0E-08 |
| sp|A5DM21|PABP_PICGU | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 | 13 | 129 | 4.0E-08 |
| sp|B0W939|NCBP2_CULQU | Nuclear cap-binding protein subunit 2 OS=Culex quinquefasciatus GN=Cbp20 PE=3 SV=1 | 13 | 87 | 4.0E-08 |
| sp|Q28IQ9|CIRBP_XENTR | Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 | 12 | 89 | 4.0E-08 |
| sp|Q13310|PABP4_HUMAN | Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 | 15 | 129 | 5.0E-08 |
| sp|Q96E39|RMXL1_HUMAN | RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 | 8 | 90 | 5.0E-08 |
| sp|P52912|TIA1_MOUSE | Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 | 8 | 124 | 5.0E-08 |
| sp|Q01085|TIAR_HUMAN | Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 | 14 | 127 | 5.0E-08 |
| sp|P70372|ELAV1_MOUSE | ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 | 31 | 129 | 5.0E-08 |
| sp|Q91VM5|RMXL1_MOUSE | RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 | 8 | 90 | 5.0E-08 |
| sp|P31483|TIA1_HUMAN | Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 | 8 | 124 | 6.0E-08 |
| sp|Q9SEU4|SRC33_ARATH | Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 | 8 | 99 | 6.0E-08 |
| sp|Q4VXU2|PAP1L_HUMAN | Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 | 15 | 134 | 7.0E-08 |
| sp|Q15717|ELAV1_HUMAN | ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 | 31 | 129 | 7.0E-08 |
| sp|Q4V898|RBMX_RAT | RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 | 8 | 90 | 7.0E-08 |
| sp|Q9WV02|RBMX_MOUSE | RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 | 8 | 90 | 7.0E-08 |
| sp|Q9XFD1|NCBP2_ARATH | Nuclear cap-binding protein subunit 2 OS=Arabidopsis thaliana GN=CBP20 PE=1 SV=1 | 13 | 87 | 7.0E-08 |
| sp|Q14576|ELAV3_HUMAN | ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 | 35 | 129 | 7.0E-08 |
| sp|Q60900|ELAV3_MOUSE | ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 | 35 | 129 | 7.0E-08 |
| sp|Q8JGR6|NCBP2_DANRE | Nuclear cap-binding protein subunit 2 OS=Danio rerio GN=ncbp2 PE=2 SV=2 | 7 | 87 | 7.0E-08 |
| sp|Q91903|ELAV2_XENLA | ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 | 9 | 129 | 7.0E-08 |
| sp|Q4R7F0|RBMX_MACFA | RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 | 8 | 90 | 7.0E-08 |
| sp|A5A6M3|RBMX_PANTR | RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 | 8 | 90 | 7.0E-08 |
| sp|P38159|RBMX_HUMAN | RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 | 8 | 90 | 7.0E-08 |
| sp|Q08935|ROC1_NICSY | 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 | 15 | 88 | 8.0E-08 |
| sp|B7P877|NCBP2_IXOSC | Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 | 13 | 87 | 8.0E-08 |
| sp|Q15415|RBY1F_HUMAN | RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 | 8 | 89 | 9.0E-08 |
| sp|C1BY64|NCBP2_ESOLU | Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 | 7 | 87 | 9.0E-08 |
| sp|Q44560|RBPA_NOSS1 | Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 | 14 | 96 | 1.0E-07 |
| sp|Q8HXM1|CSTF2_BOVIN | Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 | 14 | 95 | 1.0E-07 |
| sp|Q177H0|NCBP2_AEDAE | Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 | 13 | 87 | 1.0E-07 |
| sp|Q5RDA3|CSTF2_PONAB | Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 | 14 | 95 | 1.0E-07 |
| sp|C0H859|NCBP2_SALSA | Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 | 7 | 87 | 1.0E-07 |
| sp|Q9LHP2|SL30A_ARATH | Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 | 8 | 113 | 1.0E-07 |
| sp|Q9ZUU4|CP29B_ARATH | RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 | 15 | 87 | 1.0E-07 |
| sp|Q8BIQ5|CSTF2_MOUSE | Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 | 14 | 95 | 1.0E-07 |
| sp|Q24668|SXL_DROSU | Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 | 6 | 128 | 1.0E-07 |
| sp|P33240|CSTF2_HUMAN | Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 | 14 | 95 | 1.0E-07 |
| sp|P49313|ROC1_NICPL | 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 | 15 | 88 | 1.0E-07 |
| sp|O01671|SXL_MEGSC | Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 | 29 | 144 | 1.0E-07 |
| sp|P19339|SXL_DROME | Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 | 29 | 128 | 1.0E-07 |
| sp|Q9EPH8|PABP1_RAT | Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 | 11 | 129 | 2.0E-07 |
| sp|P29341|PABP1_MOUSE | Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 | 15 | 129 | 2.0E-07 |
| sp|P0DJD3|RBY1A_HUMAN | RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 | 8 | 89 | 2.0E-07 |
| sp|P0C7P1|RBY1D_HUMAN | RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 | 8 | 89 | 2.0E-07 |
| sp|A6NEQ0|RBY1E_HUMAN | RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 | 8 | 89 | 2.0E-07 |
| sp|P0DJD4|RBY1C_HUMAN | RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 | 8 | 89 | 2.0E-07 |
| sp|A6NDE4|RBY1B_HUMAN | RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 | 8 | 89 | 2.0E-07 |
| sp|D4AE41|RMXL1_RAT | RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 | 8 | 90 | 2.0E-07 |
| sp|P52299|NCBP2_XENLA | Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 | 11 | 87 | 2.0E-07 |
| sp|Q9LEB3|RBP47_NICPL | Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 | 14 | 132 | 2.0E-07 |
| sp|P27476|NSR1_YEAST | Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 | 3 | 130 | 2.0E-07 |
| sp|Q6DES0|NCBP2_XENTR | Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 | 13 | 87 | 2.0E-07 |
| sp|Q8VXZ9|R47BP_ARATH | Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 | 14 | 121 | 2.0E-07 |
| sp|Q1HE01|NCBP2_BOMMO | Nuclear cap-binding protein subunit 2 OS=Bombyx mori PE=2 SV=1 | 8 | 87 | 2.0E-07 |
| sp|P84586|RMXRL_RAT | RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 | 8 | 90 | 2.0E-07 |
| sp|Q09511|RSP4_CAEEL | Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 | 13 | 93 | 3.0E-07 |
| sp|Q7QCB6|NCBP2_ANOGA | Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 | 4 | 87 | 3.0E-07 |
| sp|P70318|TIAR_MOUSE | Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 | 14 | 127 | 3.0E-07 |
| sp|Q8BL97|SRSF7_MOUSE | Serine/arginine-rich splicing factor 7 OS=Mus musculus GN=Srsf7 PE=1 SV=1 | 7 | 91 | 3.0E-07 |
| sp|Q9WX39|RBPF_NOSS1 | Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 | 14 | 89 | 3.0E-07 |
| sp|O04425|FCA_ARATH | Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 | 10 | 125 | 3.0E-07 |
| sp|Q54BM2|PAP1A_DICDI | Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 | 11 | 129 | 4.0E-07 |
| sp|P04147|PABP_YEAST | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 | 13 | 129 | 4.0E-07 |
| sp|Q5RF83|CIRBP_PONAB | Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 | 12 | 89 | 4.0E-07 |
| sp|Q14011|CIRBP_HUMAN | Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 | 12 | 89 | 4.0E-07 |
| sp|O93235|CIRBA_XENLA | Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 | 12 | 89 | 5.0E-07 |
| sp|P82277|RRP2_SPIOL | 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 | 15 | 89 | 5.0E-07 |
| sp|Q5R8F7|PABP1_PONAB | Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 | 15 | 129 | 6.0E-07 |
| sp|P11940|PABP1_HUMAN | Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 | 15 | 129 | 6.0E-07 |
| sp|P61286|PABP1_BOVIN | Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 | 15 | 129 | 6.0E-07 |
| sp|P60825|CIRBP_RAT | Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 | 12 | 89 | 6.0E-07 |
| sp|P60824|CIRBP_MOUSE | Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 | 12 | 89 | 6.0E-07 |
| sp|P60826|CIRBP_CRIGR | Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 | 12 | 89 | 6.0E-07 |
| sp|B5G279|NCBP2_TAEGU | Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 | 12 | 87 | 6.0E-07 |
| sp|P19684|ROC5_NICSY | 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 | 15 | 122 | 6.0E-07 |
| sp|O75526|RMXL2_HUMAN | RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 | 8 | 90 | 6.0E-07 |
| sp|P28644|ROC1_SPIOL | 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 | 11 | 129 | 6.0E-07 |
| sp|Q29RT0|RBMX_BOVIN | RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 | 8 | 90 | 6.0E-07 |
| sp|Q6IP09|PABPB_XENLA | Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 | 15 | 130 | 7.0E-07 |
| sp|A1C646|EIF3G_ASPCL | Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif35 PE=3 SV=1 | 7 | 77 | 7.0E-07 |
| sp|O04319|PABP6_ARATH | Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 | 15 | 129 | 7.0E-07 |
| sp|Q84L14|NCBP2_ORYSJ | Nuclear cap-binding protein subunit 2 OS=Oryza sativa subsp. japonica GN=CBP20 PE=2 SV=1 | 14 | 87 | 8.0E-07 |
| sp|Q86U06|RBM23_HUMAN | Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 | 1 | 99 | 8.0E-07 |
| sp|Q13310|PABP4_HUMAN | Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 | 15 | 134 | 9.0E-07 |
| sp|Q6GLB5|ELAV1_XENTR | ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 | 31 | 129 | 9.0E-07 |
| sp|A3LXL0|PABP_PICST | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 | 13 | 129 | 1.0E-06 |
| sp|A5DW14|PABP_LODEL | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 | 13 | 129 | 1.0E-06 |
| sp|Q5AI15|PABP_CANAL | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 | 13 | 129 | 1.0E-06 |
| sp|Q9LJH8|UBP1C_ARATH | Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 | 15 | 98 | 1.0E-06 |
| sp|Q9PTX2|CIRBP_LITCT | Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 | 12 | 89 | 1.0E-06 |
| sp|A1DGS2|EIF3G_NEOFI | Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=TIF35 PE=3 SV=1 | 7 | 77 | 1.0E-06 |
| sp|O61374|SXL_CERCA | Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 | 29 | 128 | 1.0E-06 |
| sp|Q8C7E9|CSTFT_MOUSE | Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 | 14 | 95 | 1.0E-06 |
| sp|A7SKE9|EIF3G_NEMVE | Eukaryotic translation initiation factor 3 subunit G OS=Nematostella vectensis GN=v1g171563 PE=3 SV=1 | 8 | 76 | 1.0E-06 |
| sp|Q4X1I3|EIF3G_ASPFU | Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif35 PE=3 SV=1 | 7 | 77 | 1.0E-06 |
| sp|B0XS28|EIF3G_ASPFC | Eukaryotic translation initiation factor 3 subunit G OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tif35 PE=3 SV=1 | 7 | 77 | 1.0E-06 |
| sp|O22173|PABP4_ARATH | Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 | 11 | 134 | 2.0E-06 |
| sp|Q9H0L4|CSTFT_HUMAN | Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 | 14 | 95 | 2.0E-06 |
| sp|Q5U259|ELV1B_XENLA | ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 | 31 | 129 | 2.0E-06 |
| sp|A2R7Z2|EIF3G_ASPNC | Eukaryotic translation initiation factor 3 subunit G OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif35 PE=3 SV=1 | 7 | 77 | 2.0E-06 |
| sp|Q6DEY7|EPAB_XENTR | Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 | 15 | 130 | 3.0E-06 |
| sp|Q98SP8|EPABA_XENLA | Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 | 15 | 130 | 3.0E-06 |
| sp|P31209|PABP_SCHPO | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 | 15 | 141 | 3.0E-06 |
| sp|Q9H361|PABP3_HUMAN | Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 | 15 | 129 | 3.0E-06 |
| sp|Q39061|CP33_ARATH | RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 | 11 | 122 | 3.0E-06 |
| sp|Q4R813|RMXL2_MACFA | RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 | 8 | 90 | 3.0E-06 |
| sp|Q5D018|RBM8A_DANRE | RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 | 15 | 87 | 4.0E-06 |
| sp|P23241|ELAV_DROVI | Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 | 55 | 129 | 4.0E-06 |
| sp|P16914|ELAV_DROME | Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 | 55 | 129 | 4.0E-06 |
| sp|Q1DXH0|PABP_COCIM | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 | 15 | 129 | 5.0E-06 |
| sp|Q9FPJ8|RB45A_ARATH | Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 | 14 | 135 | 5.0E-06 |
| sp|P38760|MIP6_YEAST | RNA-binding protein MIP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP6 PE=1 SV=1 | 11 | 137 | 5.0E-06 |
| sp|Q74ZS6|PABP_ASHGO | Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 | 11 | 129 | 6.0E-06 |
| sp|Q8L716|U2A2B_ARATH | Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 | 15 | 89 | 7.0E-06 |
| sp|Q9M9G6|CTF64_ARATH | Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 | 14 | 93 | 7.0E-06 |
| sp|Q6GR16|EPABB_XENLA | Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 | 15 | 130 | 8.0E-06 |
| sp|Q9BRL6|SRSF8_HUMAN | Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 | 14 | 89 | 8.0E-06 |
| sp|Q9SX80|R47CP_ARATH | Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 | 14 | 130 | 8.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003723 | RNA binding | Yes |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0003676 | nucleic acid binding | No |
| GO:0003674 | molecular_function | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Nucleus | Nuclear localization signal | 0.3957 | 0.7572 | 0.2144 | 0.0656 | 0.178 | 0.0026 | 0.099 | 0.0823 | 0.0444 | 0.0355 |
| Orthofinder run ID | 4 |
| Orthogroup | 2898 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|4831 MAQNRHWEQDKEATVYIGNIDERASTAMVYEIMLQMGPIHNIHMPRDRVTQNHQGFGFVEFRGPQDAEYAAQVMN GIKLFGKPLRVNKASADKQKGADVGAELFVGNLDHMADEKILYDTFGRFGPLLSLPKQRRRHRQPQRPVHP* |
| Coding | >Hirsu2|4831 ATGGCGCAAAATCGGCACTGGGAGCAGGACAAGGAGGCGACGGTGTACATCGGCAACATCGACGAGCGGGCGTCG ACGGCCATGGTGTACGAGATCATGCTGCAGATGGGCCCGATCCACAACATCCACATGCCGCGCGACCGGGTGACG CAGAACCACCAGGGCTTCGGCTTCGTCGAGTTCCGCGGCCCGCAGGACGCCGAGTACGCGGCGCAGGTGATGAAC GGCATCAAGCTGTTCGGCAAGCCGCTGCGCGTCAACAAGGCCAGCGCCGACAAGCAGAAGGGCGCCGACGTCGGC GCCGAGCTCTTCGTCGGCAACCTCGACCACATGGCCGACGAGAAGATCCTGTACGACACCTTTGGCCGCTTCGGC CCGCTGCTCAGCCTGCCCAAGCAGCGACGCCGCCATCGCCAACCTCAACGGCCAGTACATCCTTAG |
| Transcript | >Hirsu2|4831 ATGGCGCAAAATCGGCACTGGGAGCAGGACAAGGAGGCGACGGTGTACATCGGCAACATCGACGAGCGGGCGTCG ACGGCCATGGTGTACGAGATCATGCTGCAGATGGGCCCGATCCACAACATCCACATGCCGCGCGACCGGGTGACG CAGAACCACCAGGGCTTCGGCTTCGTCGAGTTCCGCGGCCCGCAGGACGCCGAGTACGCGGCGCAGGTGATGAAC GGCATCAAGCTGTTCGGCAAGCCGCTGCGCGTCAACAAGGCCAGCGCCGACAAGCAGAAGGGCGCCGACGTCGGC GCCGAGCTCTTCGTCGGCAACCTCGACCACATGGCCGACGAGAAGATCCTGTACGACACCTTTGGCCGCTTCGGC CCGCTGCTCAGCCTGCCCAAGCAGCGACGCCGCCATCGCCAACCTCAACGGCCAGTACATCCTTAG |
| Gene | >Hirsu2|4831 ATGGCGCAAAATCGGCACTGGTGAGTGAGCTTCCCGACACAGGGCCAGGGAGGAGGGATGCGCACGCACGCACGC ACGCGCGAGAGAGAGGGAGACTGACGAGGAACGCGTCGACCTCGGCTCCAGGGAGCAGGACAAGGAGGCGACGGT GTACATCGGCAACATCGACGAGCGGGCGTCGACGGCCATGGTGTACGAGATCATGCTGCAGATGGGCCCGATCCA CAACATCCACATGCCGCGCGACCGGGTGACGCAGAACCACCAGGGCTTCGGCTTCGTCGAGTTCCGCGGCCCGCA GGACGCCGAGTACGCGGCGCAGGTGATGAACGGCATCAAGCTGTTCGGCAAGCCGCTGCGCGTCAACAAGGCCAG CGCCGACAAGCAGAAGGGCGCCGACGTCGGCGCCGAGCTCTTCGTCGGCAACCTCGACCACATGGCCGACGAGAA GATCCTGTACGACACCTTTGGCCGCTTCGGCCCGCTGCTCAGCCTGCCCAAGGTGGCGCGCGACGACAGCGGCAA CAGCAAGGGCTTCGGCTTCGTCAGCTTCGCCGACTTCGACAGCAGCGACGCCGCCATCGCCAACCTCAACGGCCA GTACATCCTTAG |