Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4829
Gene name
LocationContig_2431:45..565
Strand-
Gene length (bp)520
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00221 Lyase_aromatic Aromatic amino acid lyase 2.1E-14 37 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96V77|PALY_USTMA Phenylalanine ammonia-lyase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAL1 PE=3 SV=2 22 96 4.0E-12
sp|P11544|PALY_RHOTO Phenylalanine/tyrosine ammonia-lyase OS=Rhodosporidium toruloides GN=PAL PE=1 SV=2 28 118 6.0E-11
sp|P10248|PALY_RHOMI Phenylalanine ammonia-lyase OS=Rhodotorula mucilaginosa GN=PAL PE=3 SV=2 30 119 1.0E-10
sp|O93967|PALY_AMAMU Phenylalanine ammonia-lyase OS=Amanita muscaria GN=PAL PE=2 SV=1 5 115 6.0E-08
sp|P45725|PAL3_ARATH Phenylalanine ammonia-lyase 3 OS=Arabidopsis thaliana GN=PAL3 PE=1 SV=3 15 121 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4829
MTGPKSSAHTSATLQIWRRLRDLRAKKASIVLDGDSLDIASVVAVARHGVKPVISSDPDLARRLDLSVDALAAYI
ARDWVVYGVNTGFGGSADARTDHLVDLQVHLLQHTQSAIVTSADRDPAANSERQPGHVMPPETCAATAPSASPSC
AASSTCCTTT*
Coding >Hirsu2|4829
ATGACGGGGCCCAAGTCGTCGGCGCACACCAGCGCAACGCTCCAGATCTGGAGGCGGCTGCGGGACCTCCGGGCC
AAGAAGGCCTCCATCGTCCTCGACGGCGACAGCCTCGACATCGCCTCCGTCGTCGCCGTCGCCCGCCATGGCGTC
AAGCCCGTCATCAGCTCCGACCCGGACCTGGCCCGCCGCCTCGACCTCAGCGTCGACGCCCTGGCCGCCTACATC
GCCCGCGACTGGGTCGTCTACGGCGTCAACACCGGCTTCGGCGGCAGCGCCGACGCCCGCACCGACCACCTCGTC
GACCTCCAGGTCCACCTGCTGCAGCACACCCAGAGCGCCATCGTCACCAGCGCCGACCGCGACCCGGCCGCCAAC
TCGGAGCGCCAGCCCGGCCACGTCATGCCGCCCGAAACCTGCGCGGCCACAGCGCCGTCCGCCTCGCCGTCCTGC
GCCGCCTCGTCGACATGCTGCACCACGACCTGA
Transcript >Hirsu2|4829
ATGACGGGGCCCAAGTCGTCGGCGCACACCAGCGCAACGCTCCAGATCTGGAGGCGGCTGCGGGACCTCCGGGCC
AAGAAGGCCTCCATCGTCCTCGACGGCGACAGCCTCGACATCGCCTCCGTCGTCGCCGTCGCCCGCCATGGCGTC
AAGCCCGTCATCAGCTCCGACCCGGACCTGGCCCGCCGCCTCGACCTCAGCGTCGACGCCCTGGCCGCCTACATC
GCCCGCGACTGGGTCGTCTACGGCGTCAACACCGGCTTCGGCGGCAGCGCCGACGCCCGCACCGACCACCTCGTC
GACCTCCAGGTCCACCTGCTGCAGCACACCCAGAGCGCCATCGTCACCAGCGCCGACCGCGACCCGGCCGCCAAC
TCGGAGCGCCAGCCCGGCCACGTCATGCCGCCCGAAACCTGCGCGGCCACAGCGCCGTCCGCCTCGCCGTCCTGC
GCCGCCTCGTCGACATGCTGCACCACGACCTGA
Gene >Hirsu2|4829
ATGACGGGGCCCAAGTCGTCGGCGCACACCAGCGCAACGCTCCAGATCTGGAGGCGGCTGCGGGACCTCCGGGCC
AAGAAGGCCTCCATCGTCCTCGACGGCGACAGCCTCGACATCGCCTCCGTCGTCGCCGTCGCCCGCCATGGCGTC
AAGCCCGTCATCAGCTCCGACCCGGACCTGGCCCGCCGCCTCGACCTCAGCGTCGACGCCCTGGCCGCCTACATC
GCCCGCGACTGGGTCGTCTACGGCGTCAACACCGGCTTCGGCGGCAGCGCCGACGCCCGCACCGACCACCTCGTC
GACCTCCAGGTCCACCTGCTGCAGCACACCCAGAGCGCCATCGTCACCAGCGCCGACCGCGACCCGGCCGCCAAC
TCGGAGCGCCAGCCCGGCCACGTCATGCCGCCCGAGTGGGTGCGCGGCGCCATCGTCGCCCGCGCCAACCAGAAC
CTGCGCGGCCACAGCGCCGTCCGCCTCGCCGTCCTGCGCCGCCTCGTCGACATGCTGCACCACGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail