Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4826
Gene name
LocationContig_243:22818..23902
Strand-
Gene length (bp)1084
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12351 Fig1 Ca2+ regulator and membrane fusion protein Fig1 1.3E-58 75 256
PF06687 SUR7 SUR7/PalI family 2.0E-07 20 248

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0016020 membrane Yes
GO:0032220 plasma membrane fusion involved in cytogamy Yes
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0022414 reproductive process No
GO:0045026 plasma membrane fusion No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0061024 membrane organization No
GO:0044464 cell part No
GO:0016043 cellular component organization No
GO:0061025 membrane fusion No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 140 162 22
3 182 204 22
4 235 257 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4826
MPQFQVGWARFIPFLGYHHVLMILIAVAIILLSLLLAGCSSSSPLIPDIFLLSLYYQHYEAVPDTAQVDYNLHTA
MENIAGAASLQARVGYFGICVNPDGGSWLCSNNATSLAKEVSVDQDPLNLIWLAAQFKDMIVFPYLIIIAIIFAF
LCFILLATFPGWHEEEDSEGSEREVKPFPSRPVSQVALAIIFIASIFVLVSVLWQHTASVAASVIAQDFGNGAVR
SGVGTSAMVMGWFSFTLLIIVTIGLLVMILSIRVLGQLMRDN*
Coding >Hirsu2|4826
ATGCCTCAGTTCCAGGTCGGCTGGGCCCGGTTCATACCGTTCCTGGGCTACCACCATGTCCTGATGATCCTGATA
GCGGTGGCCATCATATTATTATCACTGCTCCTGGCCGGCTGCTCGTCGTCGTCGCCGCTGATCCCCGACATCTTC
CTCCTCTCGCTGTACTACCAGCACTACGAGGCCGTGCCGGACACGGCGCAGGTCGACTACAACCTGCACACGGCC
ATGGAGAACATCGCGGGCGCGGCCAGCCTGCAGGCCCGCGTCGGCTACTTCGGCATCTGCGTCAACCCGGACGGC
GGCTCGTGGCTGTGTAGCAACAACGCGACCTCGCTGGCCAAGGAGGTCTCGGTCGACCAGGACCCGCTCAACCTG
ATCTGGCTGGCGGCCCAGTTCAAGGACATGATTGTCTTTCCGTACCTCATCATCATCGCCATCATCTTCGCCTTC
CTCTGCTTCATCCTGCTCGCCACCTTCCCGGGCTGGCACGAGGAGGAGGACTCGGAGGGCTCGGAGCGCGAAGTG
AAGCCGTTCCCGTCGCGGCCCGTGTCGCAGGTGGCGCTGGCCATCATCTTCATCGCCTCCATCTTCGTGTTGGTG
TCGGTGCTGTGGCAGCACACGGCCTCGGTCGCGGCCTCGGTCATCGCCCAGGACTTCGGCAACGGCGCCGTCCGC
AGCGGCGTCGGCACCAGCGCCATGGTCATGGGCTGGTTCTCCTTCACCCTGCTCATCATCGTCACCATCGGCCTG
CTCGTCATGATCCTCAGCATCCGCGTCCTCGGCCAGCTGATGCGCGACAACTGA
Transcript >Hirsu2|4826
ATGCCTCAGTTCCAGGTCGGCTGGGCCCGGTTCATACCGTTCCTGGGCTACCACCATGTCCTGATGATCCTGATA
GCGGTGGCCATCATATTATTATCACTGCTCCTGGCCGGCTGCTCGTCGTCGTCGCCGCTGATCCCCGACATCTTC
CTCCTCTCGCTGTACTACCAGCACTACGAGGCCGTGCCGGACACGGCGCAGGTCGACTACAACCTGCACACGGCC
ATGGAGAACATCGCGGGCGCGGCCAGCCTGCAGGCCCGCGTCGGCTACTTCGGCATCTGCGTCAACCCGGACGGC
GGCTCGTGGCTGTGTAGCAACAACGCGACCTCGCTGGCCAAGGAGGTCTCGGTCGACCAGGACCCGCTCAACCTG
ATCTGGCTGGCGGCCCAGTTCAAGGACATGATTGTCTTTCCGTACCTCATCATCATCGCCATCATCTTCGCCTTC
CTCTGCTTCATCCTGCTCGCCACCTTCCCGGGCTGGCACGAGGAGGAGGACTCGGAGGGCTCGGAGCGCGAAGTG
AAGCCGTTCCCGTCGCGGCCCGTGTCGCAGGTGGCGCTGGCCATCATCTTCATCGCCTCCATCTTCGTGTTGGTG
TCGGTGCTGTGGCAGCACACGGCCTCGGTCGCGGCCTCGGTCATCGCCCAGGACTTCGGCAACGGCGCCGTCCGC
AGCGGCGTCGGCACCAGCGCCATGGTCATGGGCTGGTTCTCCTTCACCCTGCTCATCATCGTCACCATCGGCCTG
CTCGTCATGATCCTCAGCATCCGCGTCCTCGGCCAGCTGATGCGCGACAACTGA
Gene >Hirsu2|4826
ATGCCTCAGTTCCAGGTCGGCTGGGCCCGTGAGTCTCTTCCTCTTCTTGAGCGGCTGGAATGCGCCGACCTGGCG
GCCACGATGGCGACGAGGCGGGAGAAGAACTGACGCCGCGTCCTTCTAGGGTTCATACCGTTCCTGGGCTACCAC
CATGTCCTGATGATCCTGATAGCGGTGGCCATCATATTATTATGTACGTTCCCTCCCTCTCTCCGCGTGGCCCTG
GGAGCACTGTGAAGCTGACCGAGCGAACCCCCCCCCCCCCGAAAAAGCACTGCTCCTGGCCGGCTGCTCGTCGTC
GTCGCCGCTGATCCCCGACATCTTCCTCCTCTCGCTGTACTACCAGCACTACGAGGCCGTGCCGGACACGGCGCA
GGTCGACTACAACCTGCACACGGCCATGGAGAACATCGCGGGCGCGGCCAGCCTGCAGGCCCGCGTCGGCTACTT
CGGCATCTGCGTCAACCCGGACGGCGGCTCGTGGCTGTGTAGCAACAACGCGACCTCGCTGGCCAAGGAGGTCTC
GGTCGACCAGGACCCGCTCAACCTGATCTGGCTGGCGGCCCAGTTCAAGGACATGATTGTCTTTCCGTACCTCAT
GTGCGTTTTTCCCCGTCCCTCACTCTCTCTGTCTCTTTGCCCATCTGGTGCATGAGTTGTGGATATTTGACAAAA
ACGTGCCTCGACTGACGCCCAAACGAACAGCATCATCGCCATCATCTTCGCCTTCCTCTGCTTCATCCTGCTCGC
CACCTTCCCGGGCTGGCACGAGGAGGAGGACTCGGAGGGCTCGGAGCGCGAAGTGAAGCCGTTCCCGTCGCGGCC
CGTGTCGCAGGTGGCGCTGGCCATCATCTTCATCGCCTCCATCTTCGTGTTGGTGTCGGTGCTGTGGCAGCACAC
GGCCTCGGTCGCGGCCTCGGTCATCGCCCAGGACTTCGGCAACGGCGCCGTCCGCAGCGGCGTCGGCACCAGCGC
CATGGTCATGGGCTGGTTCTCCTTCACCCTGCTCATCATCGTCACCATCGGCCTGCTCGTCATGATCCTCAGCAT
CCGCGTCCTCGGCCAGCTGATGCGCGACAACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail