Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4825
Gene name
LocationContig_243:18525..21625
Strand+
Gene length (bp)3100
Transcript length (bp)2949
Coding sequence length (bp)2949
Protein length (aa) 983

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 4.1E-171 249 981

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2GUY0|MA1B1_RAT Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus GN=Man1b1 PE=2 SV=2 244 440 2.0E-27
sp|A2AJ15|MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus GN=Man1b1 PE=1 SV=1 251 440 1.0E-26
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 244 445 2.0E-25
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 210 445 6.0E-25
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 251 440 6.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2GUY0|MA1B1_RAT Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus GN=Man1b1 PE=2 SV=2 244 440 2.0E-27
sp|A2AJ15|MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus GN=Man1b1 PE=1 SV=1 251 440 1.0E-26
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 244 445 2.0E-25
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 210 445 6.0E-25
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 251 440 6.0E-25
sp|P45701|MA1A1_RABIT Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus GN=MAN1A1 PE=1 SV=1 235 447 3.0E-24
sp|P45700|MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus GN=Man1a1 PE=1 SV=1 219 447 1.0E-23
sp|Q12205|MNL2_YEAST Putative endoplasmic reticulum mannosidase MNL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL2 PE=1 SV=1 259 449 2.0E-23
sp|Q8H116|MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana GN=MNS2 PE=1 SV=1 239 426 5.0E-23
sp|Q9C512|MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana GN=MNS1 PE=1 SV=1 238 426 6.0E-23
sp|P31723|MAN12_PENCI Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum GN=MSDC PE=1 SV=2 201 415 1.0E-22
sp|Q12563|MNS1B_ASPPH Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis GN=mns1B PE=2 SV=1 200 452 2.0E-22
sp|P33908|MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens GN=MAN1A1 PE=1 SV=3 215 447 4.0E-22
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 244 445 6.0E-22
sp|A2QAS2|MNS1B_ASPNC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mns1B PE=3 SV=1 236 452 1.0E-21
sp|O02773|MA1A1_PIG Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa GN=MAN1A1 PE=1 SV=1 215 445 2.0E-21
sp|Q2ULB2|MNS1B_ASPOR Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mns1B PE=1 SV=1 236 428 3.0E-21
sp|B8N417|MNS1B_ASPFN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mns1B PE=3 SV=2 236 428 3.0E-21
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 885 982 4.0E-21
sp|D4AV26|MNS1B_ARTBC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00035 PE=1 SV=1 237 445 6.0E-21
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 238 415 1.0E-20
sp|P53624|MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster GN=alpha-Man-Ia PE=1 SV=2 235 445 3.0E-20
sp|A1D1W1|MNS1B_NEOFI Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mns1B PE=3 SV=1 244 439 2.0E-19
sp|Q4WRZ5|MNS1B_ASPFU Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mns1B PE=3 SV=1 244 444 2.0E-19
sp|B0XMT4|MNS1B_ASPFC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mns1B PE=3 SV=1 244 444 2.0E-19
sp|Q9C512|MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana GN=MNS1 PE=1 SV=1 877 982 3.0E-19
sp|Q8H116|MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana GN=MNS2 PE=1 SV=1 877 982 9.0E-19
sp|Q93Y37|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana GN=MNS3 PE=2 SV=1 885 980 2.0E-18
sp|E9CXX8|MNS1B_COCPS Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02648 PE=1 SV=1 219 445 2.0E-18
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 240 427 3.0E-18
sp|Q93Y37|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana GN=MNS3 PE=2 SV=1 235 415 5.0E-18
sp|A2AJ15|MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus GN=Man1b1 PE=1 SV=1 885 980 7.0E-18
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 877 980 1.0E-17
sp|Q18788|MAN12_CAEEL Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans GN=C52E4.5 PE=1 SV=1 244 426 1.0E-17
sp|B2GUY0|MA1B1_RAT Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus GN=Man1b1 PE=2 SV=2 885 980 2.0E-17
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 877 980 2.0E-17
sp|P53624|MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster GN=alpha-Man-Ia PE=1 SV=2 884 980 3.0E-17
sp|Q9NR34|MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens GN=MAN1C1 PE=1 SV=1 884 980 6.0E-17
sp|Q9P7C3|MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.01c PE=1 SV=2 243 427 1.0E-16
sp|Q8J0Q0|MNS1_CANAX Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans GN=MNS1 PE=3 SV=2 244 426 2.0E-16
sp|Q9NR34|MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens GN=MAN1C1 PE=1 SV=1 244 450 7.0E-16
sp|Q8J0Q0|MNS1_CANAX Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans GN=MNS1 PE=3 SV=2 887 980 2.0E-14
sp|P45700|MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus GN=Man1a1 PE=1 SV=1 884 980 3.0E-14
sp|O02773|MA1A1_PIG Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa GN=MAN1A1 PE=1 SV=1 884 980 5.0E-14
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 239 438 2.0E-13
sp|Q18788|MAN12_CAEEL Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans GN=C52E4.5 PE=1 SV=1 884 979 3.0E-13
sp|P32906|MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNS1 PE=1 SV=1 244 441 6.0E-13
sp|E9CXX8|MNS1B_COCPS Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02648 PE=1 SV=1 586 707 1.0E-12
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 864 982 4.0E-12
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 244 415 5.0E-12
sp|P33908|MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens GN=MAN1A1 PE=1 SV=3 884 978 7.0E-12
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 231 439 9.0E-12
sp|P45701|MA1A1_RABIT Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus GN=MAN1A1 PE=1 SV=1 884 978 2.0E-11
sp|Q9P7C3|MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.01c PE=1 SV=2 885 980 2.0E-11
sp|Q12205|MNL2_YEAST Putative endoplasmic reticulum mannosidase MNL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL2 PE=1 SV=1 611 981 5.0E-11
sp|D4AV26|MNS1B_ARTBC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00035 PE=1 SV=1 884 982 9.0E-11
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 255 438 3.0E-10
sp|Q2ULB2|MNS1B_ASPOR Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mns1B PE=1 SV=1 864 982 7.0E-10
sp|B8N417|MNS1B_ASPFN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mns1B PE=3 SV=2 864 982 7.0E-10
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 864 982 1.0E-09
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 245 446 1.0E-09
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 255 438 1.0E-09
sp|P31723|MAN12_PENCI Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum GN=MSDC PE=1 SV=2 879 982 2.0E-09
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 857 982 2.0E-09
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 857 982 3.0E-09
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 857 982 5.0E-09
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 884 982 6.0E-09
sp|E9CXX8|MNS1B_COCPS Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02648 PE=1 SV=1 879 982 8.0E-09
sp|A2QAS2|MNS1B_ASPNC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mns1B PE=3 SV=1 587 708 1.0E-08
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 856 980 1.0E-08
sp|Q12563|MNS1B_ASPPH Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis GN=mns1B PE=2 SV=1 879 982 2.0E-08
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 587 708 2.0E-08
sp|P31723|MAN12_PENCI Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum GN=MSDC PE=1 SV=2 587 708 3.0E-08
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 587 721 3.0E-08
sp|Q12563|MNS1B_ASPPH Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis GN=mns1B PE=2 SV=1 587 708 4.0E-08
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 587 721 6.0E-08
sp|Q2ULB2|MNS1B_ASPOR Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mns1B PE=1 SV=1 587 708 1.0E-07
sp|B8N417|MNS1B_ASPFN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mns1B PE=3 SV=2 587 708 1.0E-07
sp|A1D1W1|MNS1B_NEOFI Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mns1B PE=3 SV=1 587 708 2.0E-07
sp|Q4WRZ5|MNS1B_ASPFU Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mns1B PE=3 SV=1 587 708 2.0E-07
sp|B0XMT4|MNS1B_ASPFC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mns1B PE=3 SV=1 587 708 2.0E-07
sp|A2QAS2|MNS1B_ASPNC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mns1B PE=3 SV=1 879 982 5.0E-07
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 868 980 5.0E-07
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 227 439 6.0E-07
sp|D4AV26|MNS1B_ARTBC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00035 PE=1 SV=1 587 708 3.0E-06
sp|P32906|MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNS1 PE=1 SV=1 887 980 4.0E-06
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 237 439 4.0E-06
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 244 446 7.0E-06
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 570 708 8.0E-06
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 570 708 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0016020 membrane Yes
GO:0046872 metal ion binding No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0004559 alpha-mannosidase activity No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0015923 mannosidase activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4825
MMSRRRYRLLTLAAVVALFLLYRLSSDSWAQQQQQQQQRGGSGARPPLHRQAAPLGPDREHVKPPVGHKPQEPLR
GPPRPAVAVPDRGAADDAGRGGGRLEGGGRPAGAGDAERTTTTTVDETGDAFDKKKGAADEGSRSGTSKNKMNGA
ADNIDEADDDDDETDENAPSITWKNPPKDQPLEMPKPDDAKDHWIRPQEHYPIPVESMIPLPAGPAKKLPKIQAD
FEPESGEAIATRQHRFNMVKRTLERSWAAYKKHAWMHDELSPVSGHHRDPFCAWSATLVDALDTLWIAGLKSDFH
DAAHAVKNIDFTYTPRADIPVFETVIRYLGGLLGAYDVSGGPRGDYPFLLDKAVELAEVLMGIFDTPNRMPLLYY
QWRPQYASQPHRAGRVGVAELATLSMEFTRLAQLTGQPKYYDAVDRITDALVDLQRRGTGLPGLFPESLDASGCN
RTATDLRDAMSAAAREQVDSQEVLAEPDGFVVDRIAGLDSVLDENRRKEETASSSSPPPGPPNHQHARRGADGSF
ASSSSSSSADVGSADAAPGAATKTKEGRAGPYGANGKLVDWDCVPQGLVPASSTTEKYHMGGGQDSAYEYFPKQF
LLLGGREPKYQKLYEDAADAVAERLLFRPMTPVNRDVLFPAKLSTSGSSPDDFRREYEVAHLTCFIGGMFGLGGR
LFSRDADIELAKKLTDGCVWAYESTASGIMPEAANVLPCASKESCEFDEALWWAALDPSKDWREQRVRAWDTQQA
KAKTAPAPRRDESPPSGGIQRRAVLPDTRGRSGDKKKPVDDFEGSALPASLRNKLGGRFGGADGKAESDADGPKK
ASSADKSARVRQQDEEHPVAPEKKKPVSDRPQTHEEYVKHIIERNGLPPGWVSVARPEYILRPEAIESVWYMHRI
SGNVAWQNKGWKMFEDVSRATRTSMANSAVDNVMKKEPTPKDEMESFWIGETLKYFLLLFSTPDVISLDEWVLNT
EAHPFKL*
Coding >Hirsu2|4825
ATGATGTCGAGACGCAGATACCGGCTCTTGACCCTCGCCGCCGTCGTCGCCCTCTTCCTGCTCTACCGCCTCTCC
TCGGACTCCTGGGCCCAGCAGCAGCAGCAGCAGCAGCAGCGGGGGGGGAGCGGCGCCCGCCCGCCGCTGCATCGC
CAGGCCGCGCCGCTGGGGCCCGACCGCGAGCACGTCAAGCCGCCGGTCGGCCATAAGCCGCAGGAGCCGCTGAGG
GGCCCGCCGAGGCCCGCCGTCGCCGTCCCGGACCGAGGTGCTGCTGATGATGCCGGTCGTGGGGGCGGCCGGCTG
GAGGGCGGGGGCCGGCCGGCCGGTGCGGGGGACGCGGAGCGGACGACGACAACGACGGTCGACGAGACCGGCGAC
GCCTTCGACAAGAAGAAGGGCGCTGCAGACGAGGGCAGCCGCAGCGGCACCTCCAAGAACAAGATGAATGGCGCC
GCTGACAACATCGACGAAGCCGACGACGACGACGACGAAACCGACGAAAACGCCCCCTCTATCACCTGGAAGAAC
CCGCCCAAGGACCAGCCGCTCGAGATGCCCAAACCCGACGACGCCAAGGACCACTGGATCAGGCCCCAGGAACAT
TACCCCATCCCCGTCGAGTCCATGATCCCCCTGCCCGCCGGGCCGGCCAAGAAGCTGCCCAAGATCCAGGCCGAC
TTCGAGCCCGAGTCCGGCGAGGCCATCGCCACCCGACAGCACCGCTTCAACATGGTGAAGAGGACCCTCGAGCGC
TCCTGGGCCGCCTACAAGAAGCACGCCTGGATGCATGACGAGCTGTCCCCCGTCTCGGGCCACCACCGCGACCCC
TTCTGCGCCTGGTCCGCCACCCTCGTCGACGCCCTCGACACCCTGTGGATCGCCGGCCTCAAGTCCGACTTCCAC
GACGCCGCCCACGCCGTCAAGAACATCGACTTCACCTACACTCCGCGCGCCGACATCCCCGTCTTCGAGACCGTC
ATACGCTACCTCGGCGGCCTGCTCGGCGCCTACGACGTCAGCGGCGGGCCCCGCGGCGACTACCCCTTCCTGCTC
GACAAGGCCGTCGAGCTCGCCGAGGTCCTCATGGGCATCTTCGACACCCCCAACCGCATGCCCCTGCTCTACTAC
CAGTGGCGGCCCCAGTACGCCTCCCAGCCGCACCGCGCTGGCCGCGTCGGCGTCGCCGAGCTCGCCACCCTGTCC
ATGGAGTTCACCCGCCTCGCCCAGCTCACCGGCCAGCCCAAATACTACGACGCCGTCGACCGCATCACCGACGCC
CTCGTCGACCTGCAGAGGCGCGGCACAGGCCTCCCCGGCCTGTTCCCCGAGTCTCTCGACGCCTCCGGCTGCAAC
AGGACCGCCACCGACCTGCGAGACGCGATGAGCGCCGCCGCTCGTGAGCAGGTCGATTCGCAGGAGGTCCTCGCC
GAGCCCGACGGCTTCGTCGTCGACCGCATCGCCGGCCTCGACTCGGTCCTCGACGAGAACAGGCGCAAGGAGGAA
ACGGCCTCTTCTTCTTCCCCTCCTCCTGGCCCCCCCAATCACCAACACGCCCGCCGCGGCGCCGACGGCTCCTTC
GCATCGTCGTCTTCGTCGTCTTCGGCCGATGTCGGCTCTGCAGACGCCGCACCCGGAGCCGCGACCAAGACCAAG
GAGGGACGAGCCGGGCCCTACGGCGCAAACGGGAAGCTCGTCGACTGGGACTGCGTGCCCCAGGGGCTCGTTCCC
GCCAGCTCGACGACCGAAAAATACCACATGGGAGGCGGTCAAGACTCGGCCTACGAATACTTTCCCAAGCAATTC
CTCCTCCTCGGCGGCCGCGAGCCCAAGTATCAGAAGCTGTACGAGGACGCCGCCGACGCCGTCGCCGAACGCCTC
CTGTTCCGGCCCATGACGCCTGTCAACCGCGACGTCCTGTTCCCCGCCAAGCTGAGCACCTCGGGCAGTTCCCCG
GACGACTTCCGCCGCGAGTACGAAGTCGCCCACCTGACCTGCTTCATCGGCGGCATGTTTGGCCTGGGCGGCAGG
CTCTTCTCCCGCGACGCCGACATCGAGCTCGCCAAGAAGCTGACCGACGGCTGCGTCTGGGCCTACGAGTCGACG
GCGTCCGGCATTATGCCCGAGGCGGCCAACGTACTCCCATGTGCCTCGAAAGAGTCGTGCGAGTTCGACGAGGCG
CTCTGGTGGGCCGCCCTGGACCCTTCCAAGGACTGGCGGGAGCAGCGAGTCCGCGCGTGGGATACGCAGCAGGCA
AAGGCGAAAACGGCGCCGGCCCCGCGTCGGGACGAGTCTCCTCCCTCGGGCGGCATCCAGAGGAGAGCGGTGTTG
CCCGACACGCGAGGGCGCTCCGGGGACAAGAAGAAGCCCGTCGACGATTTCGAGGGCTCGGCCCTTCCCGCCTCG
CTCAGGAACAAGCTGGGCGGCAGGTTTGGCGGCGCAGATGGCAAGGCCGAGTCCGACGCCGACGGCCCGAAGAAA
GCCTCGTCCGCGGACAAGTCTGCGCGTGTTCGTCAGCAGGACGAAGAGCACCCAGTGGCGCCGGAGAAGAAGAAG
CCGGTGTCGGACAGACCGCAGACGCACGAGGAATACGTCAAGCACATCATTGAGCGCAACGGGCTGCCCCCCGGA
TGGGTGTCGGTGGCTCGCCCCGAGTATATTCTACGACCCGAGGCCATCGAATCGGTATGGTACATGCACCGTATC
TCGGGCAACGTGGCGTGGCAGAACAAGGGGTGGAAGATGTTCGAGGACGTGTCGAGGGCGACGCGGACGTCGATG
GCCAACAGCGCCGTCGATAACGTCATGAAGAAGGAGCCGACGCCCAAGGACGAGATGGAGAGCTTCTGGATAGGC
GAGACGCTCAAGTACTTTTTGCTCCTCTTCTCCACGCCCGACGTCATCAGCCTGGACGAGTGGGTGCTGAACACG
GAGGCTCATCCGTTCAAGCTGTGA
Transcript >Hirsu2|4825
ATGATGTCGAGACGCAGATACCGGCTCTTGACCCTCGCCGCCGTCGTCGCCCTCTTCCTGCTCTACCGCCTCTCC
TCGGACTCCTGGGCCCAGCAGCAGCAGCAGCAGCAGCAGCGGGGGGGGAGCGGCGCCCGCCCGCCGCTGCATCGC
CAGGCCGCGCCGCTGGGGCCCGACCGCGAGCACGTCAAGCCGCCGGTCGGCCATAAGCCGCAGGAGCCGCTGAGG
GGCCCGCCGAGGCCCGCCGTCGCCGTCCCGGACCGAGGTGCTGCTGATGATGCCGGTCGTGGGGGCGGCCGGCTG
GAGGGCGGGGGCCGGCCGGCCGGTGCGGGGGACGCGGAGCGGACGACGACAACGACGGTCGACGAGACCGGCGAC
GCCTTCGACAAGAAGAAGGGCGCTGCAGACGAGGGCAGCCGCAGCGGCACCTCCAAGAACAAGATGAATGGCGCC
GCTGACAACATCGACGAAGCCGACGACGACGACGACGAAACCGACGAAAACGCCCCCTCTATCACCTGGAAGAAC
CCGCCCAAGGACCAGCCGCTCGAGATGCCCAAACCCGACGACGCCAAGGACCACTGGATCAGGCCCCAGGAACAT
TACCCCATCCCCGTCGAGTCCATGATCCCCCTGCCCGCCGGGCCGGCCAAGAAGCTGCCCAAGATCCAGGCCGAC
TTCGAGCCCGAGTCCGGCGAGGCCATCGCCACCCGACAGCACCGCTTCAACATGGTGAAGAGGACCCTCGAGCGC
TCCTGGGCCGCCTACAAGAAGCACGCCTGGATGCATGACGAGCTGTCCCCCGTCTCGGGCCACCACCGCGACCCC
TTCTGCGCCTGGTCCGCCACCCTCGTCGACGCCCTCGACACCCTGTGGATCGCCGGCCTCAAGTCCGACTTCCAC
GACGCCGCCCACGCCGTCAAGAACATCGACTTCACCTACACTCCGCGCGCCGACATCCCCGTCTTCGAGACCGTC
ATACGCTACCTCGGCGGCCTGCTCGGCGCCTACGACGTCAGCGGCGGGCCCCGCGGCGACTACCCCTTCCTGCTC
GACAAGGCCGTCGAGCTCGCCGAGGTCCTCATGGGCATCTTCGACACCCCCAACCGCATGCCCCTGCTCTACTAC
CAGTGGCGGCCCCAGTACGCCTCCCAGCCGCACCGCGCTGGCCGCGTCGGCGTCGCCGAGCTCGCCACCCTGTCC
ATGGAGTTCACCCGCCTCGCCCAGCTCACCGGCCAGCCCAAATACTACGACGCCGTCGACCGCATCACCGACGCC
CTCGTCGACCTGCAGAGGCGCGGCACAGGCCTCCCCGGCCTGTTCCCCGAGTCTCTCGACGCCTCCGGCTGCAAC
AGGACCGCCACCGACCTGCGAGACGCGATGAGCGCCGCCGCTCGTGAGCAGGTCGATTCGCAGGAGGTCCTCGCC
GAGCCCGACGGCTTCGTCGTCGACCGCATCGCCGGCCTCGACTCGGTCCTCGACGAGAACAGGCGCAAGGAGGAA
ACGGCCTCTTCTTCTTCCCCTCCTCCTGGCCCCCCCAATCACCAACACGCCCGCCGCGGCGCCGACGGCTCCTTC
GCATCGTCGTCTTCGTCGTCTTCGGCCGATGTCGGCTCTGCAGACGCCGCACCCGGAGCCGCGACCAAGACCAAG
GAGGGACGAGCCGGGCCCTACGGCGCAAACGGGAAGCTCGTCGACTGGGACTGCGTGCCCCAGGGGCTCGTTCCC
GCCAGCTCGACGACCGAAAAATACCACATGGGAGGCGGTCAAGACTCGGCCTACGAATACTTTCCCAAGCAATTC
CTCCTCCTCGGCGGCCGCGAGCCCAAGTATCAGAAGCTGTACGAGGACGCCGCCGACGCCGTCGCCGAACGCCTC
CTGTTCCGGCCCATGACGCCTGTCAACCGCGACGTCCTGTTCCCCGCCAAGCTGAGCACCTCGGGCAGTTCCCCG
GACGACTTCCGCCGCGAGTACGAAGTCGCCCACCTGACCTGCTTCATCGGCGGCATGTTTGGCCTGGGCGGCAGG
CTCTTCTCCCGCGACGCCGACATCGAGCTCGCCAAGAAGCTGACCGACGGCTGCGTCTGGGCCTACGAGTCGACG
GCGTCCGGCATTATGCCCGAGGCGGCCAACGTACTCCCATGTGCCTCGAAAGAGTCGTGCGAGTTCGACGAGGCG
CTCTGGTGGGCCGCCCTGGACCCTTCCAAGGACTGGCGGGAGCAGCGAGTCCGCGCGTGGGATACGCAGCAGGCA
AAGGCGAAAACGGCGCCGGCCCCGCGTCGGGACGAGTCTCCTCCCTCGGGCGGCATCCAGAGGAGAGCGGTGTTG
CCCGACACGCGAGGGCGCTCCGGGGACAAGAAGAAGCCCGTCGACGATTTCGAGGGCTCGGCCCTTCCCGCCTCG
CTCAGGAACAAGCTGGGCGGCAGGTTTGGCGGCGCAGATGGCAAGGCCGAGTCCGACGCCGACGGCCCGAAGAAA
GCCTCGTCCGCGGACAAGTCTGCGCGTGTTCGTCAGCAGGACGAAGAGCACCCAGTGGCGCCGGAGAAGAAGAAG
CCGGTGTCGGACAGACCGCAGACGCACGAGGAATACGTCAAGCACATCATTGAGCGCAACGGGCTGCCCCCCGGA
TGGGTGTCGGTGGCTCGCCCCGAGTATATTCTACGACCCGAGGCCATCGAATCGGTATGGTACATGCACCGTATC
TCGGGCAACGTGGCGTGGCAGAACAAGGGGTGGAAGATGTTCGAGGACGTGTCGAGGGCGACGCGGACGTCGATG
GCCAACAGCGCCGTCGATAACGTCATGAAGAAGGAGCCGACGCCCAAGGACGAGATGGAGAGCTTCTGGATAGGC
GAGACGCTCAAGTACTTTTTGCTCCTCTTCTCCACGCCCGACGTCATCAGCCTGGACGAGTGGGTGCTGAACACG
GAGGCTCATCCGTTCAAGCTGTGA
Gene >Hirsu2|4825
ATGATGTCGAGACGCAGATACCGGCTCTTGACCCTCGCCGCCGTCGTCGCCCTCTTCCTGCTCTACCGCCTCTCC
TCGGACTCCTGGGCCCAGCAGCAGCAGCAGCAGCAGCAGCGGGGGGGGAGCGGCGCCCGCCCGCCGCTGCATCGC
CAGGCCGCGCCGCTGGGGCCCGACCGCGAGCACGTCAAGCCGCCGGTCGGCCATAAGCCGCAGGAGCCGCTGAGG
GGCCCGCCGAGGCCCGCCGTCGCCGTCCCGGACCGAGGTGCTGCTGATGATGCCGGTCGTGGGGGCGGCCGGCTG
GAGGGCGGGGGCCGGCCGGCCGGTGCGGGGGACGCGGAGCGGACGACGACAACGACGGTCGACGAGACCGGCGAC
GCCTTCGACAAGAAGAAGGGCGCTGCAGACGAGGGCAGCCGCAGCGGCACCTCCAAGAACAAGATGAATGGCGCC
GCTGACAACATCGACGAAGCCGACGACGACGACGACGAAACCGACGAAAACGCCCCCTCTATCACCTGGAAGAAC
CCGCCCAAGGACCAGCCGCTCGAGATGCCCAAACCCGACGACGCCAAGGACCACTGGATCAGGCCCCAGGAACAT
TACCCCATCCCCGTCGAGTCCATGATCCCCCTGCCCGCCGGGCCGGCCAAGAAGCTGCCCAAGATCCAGGCCGAC
TTCGAGCCCGAGTCCGGCGAGGCCATCGCCACCCGACAGCACCGCTTCAACATGGTGAAGAGGACCCTCGAGCGC
TCCTGGGCCGCCTACAAGAAGCACGCCTGGATGCATGACGAGCTGTCCCCCGTCTCGGGCCACCACCGCGACCCC
TTCTGCGCCTGGTCCGCCACCCTCGTCGACGCCCTCGACACCCTGTGGATCGCCGGCCTCAAGTCCGACTTCCAC
GACGCCGCCCACGCCGTCAAGAACATCGACTTCACCTACACTCCGCGCGCCGACATCCCCGTCTTCGAGACCGTC
ATACGCTACCTCGGCGGCCTGCTCGGCGCCTACGACGTCAGCGGCGGGCCCCGCGGCGACTACCCCTTCCTGCTC
GACAAGGCCGTCGAGCTCGCCGAGGTCCTCATGGGCATCTTCGACACCCCCAACCGCATGCCCCTGCTCTACTAC
CAGTGGCGGCCCCAGTACGCCTCCCAGCCGCACCGCGCTGGCCGCGTCGGCGTCGCCGAGCTCGCCACCCTGTCC
ATGGAGTTCACCCGCCTCGCCCAGCTCACCGGCCAGCCCAAATACTACGACGCCGTCGACCGCATCACCGACGCC
CTCGTCGACCTGCAGAGGCGCGGCACAGGCCTCCCCGGCCTGTTCCCCGAGTCTCTCGACGCCTCCGGCTGCAAC
AGGACCGCCACCGACCTGCGAGACGCGATGAGCGCCGCCGCTCGTGAGCAGGTCGATTCGCAGGAGGTCCTCGCC
GAGCCCGACGGCTTCGTCGTCGACCGCATCGCCGGCCTCGACTCGGTCCTCGACGAGAACAGGCGCAAGGAGGAA
ACGGCCTCTTCTTCTTCCCCTCCTCCTGGCCCCCCCAATCACCAACACGCCCGCCGCGGCGCCGACGGCTCCTTC
GCATCGTCGTCTTCGTCGTCTTCGGCCGATGTCGGCTCTGCAGACGCCGCACCCGGAGCCGCGACCAAGACCAAG
GAGGGACGAGCCGGGCCCTACGGCGCAAACGGGAAGCTCGTCGACTGGGACTGCGTGCCCCAGGGGCTCGTTCCC
GCCAGCTCGACGACCGAAAAATACCACATGGGAGGCGGTCAAGACTCGGCCTACGAATACTTTCCCAAGGTAATC
AAAATCAAGCGCCGAGCCCCACGACACCGTCCCTACTGACACACGGCTTTCCCCGCAGCAATTCCTCCTCCTCGG
CGGCCGCGAGCCCAAGTATCAGAAGCTGTACGAGGACGCCGCCGACGCCGTCGCCGAACGCCTCCTGTTCCGGCC
CATGACGCCTGTCAACCGCGACGTCCTGTTCCCCGCCAAGCTGAGCACCTCGGGCAGTTCCCCGGACGACTTCCG
CCGCGAGTACGAAGTCGCCCACCTGACCTGCTTCATCGGCGGCATGTTTGGCCTGGGCGGCAGGCTCTTCTCCCG
CGACGCCGACATCGAGCTCGCCAAGAAGCTGACCGACGGCTGCGTCTGGGCCTACGAGTCGACGGCGTCCGGCAT
TATGCCCGAGGCGGCCAACGTACTCCCATGTGCCTCGAAAGAGTCGTGCGAGTTCGACGAGGCGCTCTGGTGGGC
CGCCCTGGACCCTTCCAAGGACTGGCGGGAGCAGCGAGTCCGCGCGTGGGATACGCAGCAGGCAAAGGCGAAAAC
GGCGCCGGCCCCGCGTCGGGACGAGTCTCCTCCCTCGGGCGGCATCCAGAGGAGAGCGGTGTTGCCCGACACGCG
AGGGCGCTCCGGGGACAAGAAGAAGCCCGTCGACGATTTCGAGGGCTCGGCCCTTCCCGCCTCGCTCAGGAACAA
GCTGGGCGGCAGGTTTGGCGGCGCAGATGGCAAGGCCGAGTCCGACGCCGACGGCCCGAAGAAAGCCTCGTCCGC
GGACAAGTCTGCGCGTGTTCGTCAGCAGGACGAAGAGCACCCAGTGGCGCCGGAGAAGAAGAAGCCGGTGTCGGA
CAGACCGCAGACGCACGAGGAATACGTCAAGCACATCATTGAGCGCAACGGGCTGCCCCCCGGATGGGTGTCGGT
GGCTCGCCCCGAGTATATTCTACGGTGCGTGCTCCCATCCCCCTTTGCGCTCCCTGTGATTTACGTTTCCCCTTT
CGGGTCTTCGCTAACACGGCGTCGTCGCCGTTGCAGACCCGAGGCCATCGAATCGGTATGGTACATGCACCGTAT
CTCGGGCAACGTGGCGTGGCAGAACAAGGGGTGGAAGATGTTCGAGGACGTGTCGAGGGCGACGCGGACGTCGAT
GGCCAACAGCGCCGTCGATAACGTCATGAAGAAGGAGCCGACGCCCAAGGACGAGATGGAGAGCTTCTGGATAGG
CGAGACGCTCAAGTACTTTTTGCTCCTCTTCTCCACGCCCGACGTCATCAGCCTGGACGAGTGGGTGCTGAACAC
GGAGGCTCATCCGTTCAAGCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail