Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4824
Gene name
LocationContig_243:11272..16423
Strand+
Gene length (bp)5151
Transcript length (bp)4776
Coding sequence length (bp)4776
Protein length (aa) 1592

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-61 1302 1564
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.2E-46 1302 1561
PF14531 Kinase-like Kinase-like 2.3E-06 1398 1514

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 1224 1582 1.0E-117
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 1073 1586 2.0E-100
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 1277 1567 3.0E-67
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 1282 1567 3.0E-65
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 1296 1567 5.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 1224 1582 1.0E-117
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 1073 1586 2.0E-100
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 1277 1567 3.0E-67
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 1282 1567 3.0E-65
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 1296 1567 5.0E-65
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 1299 1567 3.0E-64
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 1296 1567 6.0E-64
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 1298 1567 7.0E-63
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 1299 1569 1.0E-62
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 1299 1569 1.0E-62
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 1299 1569 6.0E-62
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 1298 1573 2.0E-60
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 1299 1565 6.0E-56
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 1299 1567 1.0E-55
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 1299 1565 2.0E-55
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 1299 1568 6.0E-53
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 1299 1568 1.0E-52
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 1299 1568 2.0E-51
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 1305 1568 5.0E-51
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 1298 1567 2.0E-50
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 1298 1567 2.0E-50
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 1298 1567 5.0E-50
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 1299 1567 3.0E-48
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 1299 1569 3.0E-48
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 1296 1568 6.0E-48
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 1302 1568 2.0E-47
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 1302 1568 3.0E-47
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 1302 1568 4.0E-47
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 1302 1571 6.0E-47
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 1293 1567 2.0E-46
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 1299 1570 2.0E-46
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 1288 1564 5.0E-46
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 1295 1562 5.0E-46
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 1295 1562 7.0E-46
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 1291 1567 2.0E-45
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 1280 1567 2.0E-45
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 1291 1567 4.0E-45
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 1293 1567 7.0E-45
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 1271 1566 1.0E-42
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 1288 1567 1.0E-42
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 1304 1567 5.0E-42
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 1304 1567 8.0E-42
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 1243 1570 6.0E-41
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 1296 1570 1.0E-40
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 1305 1562 2.0E-40
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 1299 1570 2.0E-40
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 1305 1568 4.0E-40
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 1296 1570 4.0E-40
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 1304 1564 2.0E-38
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 1303 1567 2.0E-38
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 1304 1564 2.0E-38
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 1305 1568 2.0E-38
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 1305 1562 3.0E-38
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 1292 1562 3.0E-38
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 1304 1562 9.0E-38
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 1304 1562 9.0E-38
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 1299 1568 1.0E-37
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 1305 1571 1.0E-37
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 1305 1571 1.0E-37
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 1305 1571 1.0E-37
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 1298 1568 4.0E-37
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 1305 1571 8.0E-37
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 1303 1564 1.0E-36
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 1297 1569 2.0E-36
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 1305 1570 2.0E-36
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 1291 1570 4.0E-36
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 1291 1570 4.0E-36
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 1291 1570 4.0E-36
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 1291 1570 5.0E-36
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 1282 1568 8.0E-36
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 1305 1562 1.0E-35
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 1305 1570 1.0E-35
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 1305 1572 1.0E-35
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 1282 1568 1.0E-35
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 1282 1568 1.0E-35
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 1301 1562 1.0E-35
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 1305 1568 2.0E-35
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 1298 1591 2.0E-35
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 1298 1591 2.0E-35
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 1298 1591 2.0E-35
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 1298 1570 2.0E-35
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 1298 1570 2.0E-35
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 1304 1562 2.0E-35
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 1298 1570 2.0E-35
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 1305 1567 2.0E-35
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 1304 1562 2.0E-35
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 1298 1570 2.0E-35
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 1305 1568 3.0E-35
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 1298 1591 3.0E-35
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 1306 1568 3.0E-35
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 1305 1567 3.0E-35
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 1305 1570 3.0E-35
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 1305 1568 3.0E-35
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 1305 1567 3.0E-35
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 1306 1568 4.0E-35
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 1305 1567 4.0E-35
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 1305 1568 4.0E-35
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 1305 1567 4.0E-35
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 1268 1568 4.0E-35
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 1305 1567 4.0E-35
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 1305 1567 5.0E-35
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 1305 1567 5.0E-35
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 1305 1567 5.0E-35
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 1282 1568 6.0E-35
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 1298 1591 6.0E-35
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 1305 1567 6.0E-35
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 1305 1567 6.0E-35
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 1305 1568 7.0E-35
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 1305 1567 8.0E-35
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 1305 1568 1.0E-34
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 1305 1567 1.0E-34
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 1305 1568 1.0E-34
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 1282 1567 1.0E-34
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 1301 1568 1.0E-34
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 1305 1568 1.0E-34
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 1305 1568 1.0E-34
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 1303 1568 2.0E-34
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 1305 1568 3.0E-34
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 1298 1568 3.0E-34
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 1270 1567 3.0E-34
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 1305 1586 4.0E-34
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 1305 1568 4.0E-34
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 1305 1586 5.0E-34
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 1305 1572 6.0E-34
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 1305 1567 7.0E-34
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 1305 1586 8.0E-34
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 1305 1567 1.0E-33
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 1305 1567 1.0E-33
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 1305 1568 1.0E-33
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 1280 1567 4.0E-33
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 1305 1567 4.0E-33
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 1287 1524 4.0E-33
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 1299 1562 4.0E-33
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 1306 1579 4.0E-33
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 1305 1573 5.0E-33
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 1305 1573 6.0E-33
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 1303 1567 7.0E-33
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 1279 1586 7.0E-33
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 1279 1586 8.0E-33
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 1305 1573 1.0E-32
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 1305 1571 1.0E-32
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 1305 1567 1.0E-32
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 1301 1586 2.0E-32
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 1305 1569 2.0E-32
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 1303 1567 3.0E-32
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 1305 1568 3.0E-32
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 1305 1568 3.0E-32
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 1303 1569 5.0E-32
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 1305 1571 5.0E-32
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 1305 1567 6.0E-32
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 1305 1573 6.0E-32
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 1301 1586 7.0E-32
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 1305 1571 8.0E-32
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 1303 1567 9.0E-32
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 1301 1586 9.0E-32
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 1305 1570 1.0E-31
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 1285 1571 1.0E-31
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 1305 1575 1.0E-31
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 1302 1519 2.0E-31
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 1303 1567 2.0E-31
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 1299 1576 2.0E-31
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 1303 1567 2.0E-31
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 1289 1520 3.0E-31
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 1303 1567 3.0E-31
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 1299 1568 3.0E-31
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 1305 1568 3.0E-31
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 1299 1576 4.0E-31
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 1303 1567 4.0E-31
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 1299 1576 4.0E-31
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 1306 1569 5.0E-31
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 1302 1562 5.0E-31
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 1274 1527 5.0E-31
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 1299 1576 6.0E-31
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 1305 1568 8.0E-31
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 1303 1532 8.0E-31
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 1305 1563 1.0E-30
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 1299 1576 1.0E-30
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 1305 1570 1.0E-30
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 1305 1568 1.0E-30
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 1305 1570 2.0E-30
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 1303 1590 2.0E-30
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 1305 1568 2.0E-30
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 1302 1571 2.0E-30
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 1303 1590 3.0E-30
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 1305 1570 3.0E-30
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 1281 1573 4.0E-30
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 1304 1567 4.0E-30
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 1305 1567 4.0E-30
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 1303 1584 5.0E-30
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 1302 1568 8.0E-30
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 1305 1568 9.0E-30
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 1302 1519 1.0E-29
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 1302 1524 1.0E-29
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 1303 1577 1.0E-29
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 1305 1568 1.0E-29
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 1292 1568 1.0E-29
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 1302 1527 1.0E-29
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 1303 1567 2.0E-29
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 1302 1519 2.0E-29
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 1305 1581 2.0E-29
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 1302 1527 2.0E-29
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 1298 1567 2.0E-29
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 1303 1584 2.0E-29
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 1305 1581 2.0E-29
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 1298 1519 3.0E-29
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 1303 1580 3.0E-29
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 1302 1524 5.0E-29
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 1299 1576 6.0E-29
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 1305 1567 7.0E-29
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 1305 1568 7.0E-29
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 1305 1568 7.0E-29
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 1305 1557 8.0E-29
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 1305 1568 1.0E-28
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 1351 1570 1.0E-28
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 1298 1524 1.0E-28
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 1297 1562 2.0E-28
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 1303 1584 2.0E-28
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 1305 1529 2.0E-28
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 1297 1508 2.0E-28
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 1305 1526 2.0E-28
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 1302 1567 3.0E-28
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 1305 1567 3.0E-28
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 1299 1576 3.0E-28
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 1299 1576 3.0E-28
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 1302 1527 3.0E-28
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 1298 1527 3.0E-28
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 1292 1527 3.0E-28
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 1303 1590 3.0E-28
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 1299 1576 3.0E-28
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 1299 1510 4.0E-28
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 1275 1524 4.0E-28
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 1295 1567 4.0E-28
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 1303 1567 4.0E-28
sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase-transforming protein Rmil OS=Avian retrovirus IC10 GN=V-RMIL PE=3 SV=1 1302 1556 4.0E-28
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 1298 1569 5.0E-28
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 1298 1524 5.0E-28
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 1303 1567 5.0E-28
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 1302 1581 5.0E-28
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 1276 1574 5.0E-28
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 1298 1524 6.0E-28
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 1303 1508 6.0E-28
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 1303 1508 6.0E-28
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 1302 1524 7.0E-28
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 1305 1568 9.0E-28
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 1298 1567 9.0E-28
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 1303 1584 9.0E-28
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 1284 1532 9.0E-28
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 1303 1567 9.0E-28
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 1303 1584 1.0E-27
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 1299 1576 1.0E-27
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 1297 1508 1.0E-27
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 1303 1584 1.0E-27
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 1298 1573 1.0E-27
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 1292 1567 1.0E-27
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 1302 1556 1.0E-27
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 1288 1590 2.0E-27
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 1302 1557 2.0E-27
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 1290 1567 2.0E-27
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 1305 1568 2.0E-27
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 1303 1590 2.0E-27
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 1298 1524 2.0E-27
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 1297 1562 2.0E-27
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 1302 1519 2.0E-27
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 1303 1508 2.0E-27
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 1298 1524 2.0E-27
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 1305 1557 2.0E-27
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 1297 1562 2.0E-27
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 1296 1568 2.0E-27
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 1303 1508 3.0E-27
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 1298 1524 3.0E-27
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 1305 1524 3.0E-27
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 1303 1580 3.0E-27
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 1305 1556 3.0E-27
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 1290 1568 3.0E-27
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 1297 1562 3.0E-27
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 1283 1524 4.0E-27
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 1292 1567 4.0E-27
sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 1302 1563 4.0E-27
sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 1302 1563 4.0E-27
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 1305 1508 5.0E-27
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 1306 1563 5.0E-27
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 1305 1508 5.0E-27
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 1303 1508 6.0E-27
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 1298 1524 6.0E-27
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 1303 1580 6.0E-27
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 1275 1524 6.0E-27
sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 1302 1563 7.0E-27
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 1303 1591 7.0E-27
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 1302 1527 7.0E-27
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 1303 1567 7.0E-27
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 1299 1576 7.0E-27
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 1305 1574 7.0E-27
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 1303 1562 8.0E-27
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 1303 1573 8.0E-27
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 1292 1567 9.0E-27
sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 1302 1563 1.0E-26
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 1312 1567 1.0E-26
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 1303 1580 1.0E-26
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 1299 1567 1.0E-26
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 1298 1539 1.0E-26
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 1303 1508 2.0E-26
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 1305 1567 2.0E-26
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 1299 1518 2.0E-26
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 1305 1567 2.0E-26
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 1303 1562 2.0E-26
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 1302 1527 2.0E-26
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 1297 1572 3.0E-26
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 1305 1567 3.0E-26
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 1303 1590 3.0E-26
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 1305 1520 3.0E-26
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 1298 1524 4.0E-26
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 1299 1567 4.0E-26
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 1303 1532 4.0E-26
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 1301 1567 4.0E-26
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 1303 1567 4.0E-26
sp|Q2RA93|WNK6_ORYSJ Probable serine/threonine-protein kinase WNK6 OS=Oryza sativa subsp. japonica GN=WNK6 PE=2 SV=1 1303 1526 4.0E-26
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 1304 1567 4.0E-26
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 1292 1559 4.0E-26
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 1300 1567 4.0E-26
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 1303 1572 5.0E-26
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 1303 1545 5.0E-26
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 1303 1508 5.0E-26
sp|Q80XI6|M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus GN=Map3k11 PE=1 SV=1 1303 1564 5.0E-26
sp|Q66HA1|M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus GN=Map3k11 PE=1 SV=1 1303 1564 5.0E-26
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 1298 1564 5.0E-26
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 1292 1559 5.0E-26
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 1292 1559 5.0E-26
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 1302 1557 6.0E-26
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 1293 1562 6.0E-26
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 1292 1559 6.0E-26
sp|Q16584|M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens GN=MAP3K11 PE=1 SV=1 1303 1564 6.0E-26
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 1298 1524 7.0E-26
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 1293 1570 7.0E-26
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 1305 1570 7.0E-26
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 1304 1530 8.0E-26
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 1298 1555 8.0E-26
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 1306 1591 8.0E-26
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1290 1531 8.0E-26
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 1305 1567 8.0E-26
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 1285 1539 8.0E-26
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 1304 1562 9.0E-26
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 1345 1552 9.0E-26
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 1297 1572 9.0E-26
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 1305 1570 9.0E-26
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 1302 1567 1.0E-25
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 1284 1590 1.0E-25
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 1303 1557 1.0E-25
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 1304 1517 1.0E-25
sp|P48479|NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nim-1 PE=2 SV=2 1305 1563 1.0E-25
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 1280 1527 1.0E-25
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 1305 1532 1.0E-25
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 1303 1501 1.0E-25
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 1303 1565 1.0E-25
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 1297 1519 1.0E-25
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 1299 1567 1.0E-25
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 1302 1524 1.0E-25
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 1303 1567 1.0E-25
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 1298 1567 1.0E-25
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 1302 1525 1.0E-25
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 1304 1532 1.0E-25
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 1299 1521 1.0E-25
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 1303 1523 1.0E-25
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 1298 1568 1.0E-25
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 1305 1524 1.0E-25
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 1292 1524 2.0E-25
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 1289 1524 2.0E-25
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 1305 1567 2.0E-25
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 1305 1567 2.0E-25
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 1305 1556 2.0E-25
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 1302 1524 2.0E-25
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 1303 1567 2.0E-25
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 1298 1564 2.0E-25
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 1286 1567 2.0E-25
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 1298 1568 2.0E-25
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 1298 1568 2.0E-25
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 1305 1567 2.0E-25
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 1303 1562 2.0E-25
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 1289 1569 2.0E-25
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 1291 1520 2.0E-25
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 1298 1567 2.0E-25
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 1298 1525 2.0E-25
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 1302 1511 2.0E-25
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 1298 1520 2.0E-25
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 1298 1524 2.0E-25
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 1305 1567 2.0E-25
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 1288 1527 3.0E-25
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 1305 1563 3.0E-25
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 1302 1527 3.0E-25
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 1291 1555 3.0E-25
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 1305 1567 3.0E-25
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 1302 1519 3.0E-25
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 1292 1559 3.0E-25
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 1285 1539 3.0E-25
sp|P51813|BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens GN=BMX PE=1 SV=1 1305 1563 3.0E-25
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 1298 1567 3.0E-25
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 1305 1532 3.0E-25
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 1303 1557 4.0E-25
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 1299 1510 4.0E-25
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 1305 1567 4.0E-25
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 1302 1567 4.0E-25
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 1290 1531 5.0E-25
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 1303 1591 5.0E-25
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 1299 1557 5.0E-25
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 1299 1567 5.0E-25
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 1292 1559 5.0E-25
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 1298 1567 5.0E-25
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 1299 1567 5.0E-25
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 1302 1529 5.0E-25
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 1307 1568 6.0E-25
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 1299 1568 6.0E-25
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 1302 1568 6.0E-25
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 1305 1558 6.0E-25
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 1300 1572 6.0E-25
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 1289 1568 6.0E-25
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 1298 1519 7.0E-25
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 1304 1529 7.0E-25
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 1303 1532 7.0E-25
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 1273 1517 7.0E-25
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 1281 1563 8.0E-25
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 1302 1557 8.0E-25
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 1305 1562 8.0E-25
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 1292 1505 9.0E-25
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 1299 1510 1.0E-24
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 1292 1505 1.0E-24
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 1299 1567 1.0E-24
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 1299 1510 1.0E-24
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 1292 1567 1.0E-24
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 1305 1574 1.0E-24
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 1305 1568 1.0E-24
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 1303 1508 1.0E-24
sp|Q99558|M3K14_HUMAN Mitogen-activated protein kinase kinase kinase 14 OS=Homo sapiens GN=MAP3K14 PE=1 SV=2 1297 1561 1.0E-24
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 1303 1557 1.0E-24
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 1299 1567 1.0E-24
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 1303 1529 1.0E-24
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 1291 1508 1.0E-24
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 1285 1563 1.0E-24
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 1303 1567 1.0E-24
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 1292 1505 1.0E-24
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 1261 1567 2.0E-24
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 1305 1567 2.0E-24
sp|Q23977|HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster GN=hep PE=1 SV=2 1305 1570 2.0E-24
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 1304 1529 2.0E-24
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 1304 1529 2.0E-24
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 1303 1508 2.0E-24
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 1303 1564 2.0E-24
sp|P00531|MIL_AVIMH Serine/threonine-protein kinase-transforming protein mil OS=Avian retrovirus MH2 GN=V-MIL PE=3 SV=1 1305 1563 2.0E-24
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 1300 1572 2.0E-24
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 1302 1520 2.0E-24
sp|P00532|RAF_MSV36 Serine/threonine-protein kinase-transforming protein raf OS=Murine sarcoma virus 3611 GN=V-RAF PE=3 SV=1 1305 1563 2.0E-24
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 1292 1508 2.0E-24
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 1292 1505 2.0E-24
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1303 1567 2.0E-24
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 1305 1532 2.0E-24
sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 1305 1563 2.0E-24
sp|Q54H46|DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum GN=drkA PE=3 SV=1 1302 1564 2.0E-24
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 1303 1567 2.0E-24
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 1284 1508 2.0E-24
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 1303 1567 3.0E-24
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 1298 1577 3.0E-24
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 1303 1577 3.0E-24
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 1304 1529 3.0E-24
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 1303 1567 3.0E-24
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 1292 1505 3.0E-24
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 1303 1532 3.0E-24
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 1276 1539 3.0E-24
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 1297 1569 3.0E-24
sp|P11346|KRAF1_DROME Raf homolog serine/threonine-protein kinase phl OS=Drosophila melanogaster GN=phl PE=1 SV=6 1305 1563 3.0E-24
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 1282 1567 3.0E-24
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1303 1555 3.0E-24
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 1298 1567 3.0E-24
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 1284 1524 3.0E-24
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 1303 1567 4.0E-24
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 1298 1524 4.0E-24
sp|Q6I5Y0|CDKC1_ORYSJ Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1 1301 1505 4.0E-24
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 1284 1524 4.0E-24
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 1302 1562 4.0E-24
sp|P11345|RAF1_RAT RAF proto-oncogene serine/threonine-protein kinase OS=Rattus norvegicus GN=Raf1 PE=1 SV=1 1305 1563 4.0E-24
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 1284 1556 4.0E-24
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 1304 1508 5.0E-24
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 1297 1573 5.0E-24
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1303 1555 5.0E-24
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 1366 1560 5.0E-24
sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 1305 1563 5.0E-24
sp|Q60855|RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Ripk1 PE=1 SV=1 1305 1557 5.0E-24
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 1298 1567 5.0E-24
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 1303 1564 7.0E-24
sp|A7E3S4|RAF1_BOVIN RAF proto-oncogene serine/threonine-protein kinase OS=Bos taurus GN=RAF1 PE=2 SV=1 1305 1563 7.0E-24
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 1301 1567 7.0E-24
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1302 1511 7.0E-24
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 1299 1559 7.0E-24
sp|Q5R5M7|RAF1_PONAB RAF proto-oncogene serine/threonine-protein kinase OS=Pongo abelii GN=RAF1 PE=2 SV=1 1305 1563 7.0E-24
sp|P04049|RAF1_HUMAN RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens GN=RAF1 PE=1 SV=1 1305 1563 7.0E-24
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 1275 1511 8.0E-24
sp|Q95UN8|M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster GN=slpr PE=1 SV=1 1303 1564 9.0E-24
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 1298 1524 9.0E-24
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 1305 1539 9.0E-24
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 1303 1564 1.0E-23
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 1305 1567 1.0E-23
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 1305 1567 1.0E-23
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 1302 1567 1.0E-23
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 1305 1567 7.0E-14
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 1353 1567 1.0E-12
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 1353 1568 3.0E-12
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 1353 1568 5.0E-12
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 1353 1568 6.0E-12
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 1305 1524 2.0E-11
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 580 681 3.0E-10
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 1395 1508 9.0E-09
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 1395 1508 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4824
MAAPPLSNIMSIPPPPPPPLPRYPAPAPGGIIPPPPAGPPPALPPANALGPQPSWHGNYGRVYDGRSAVPLPMPH
QHHQPYNPKLHAQMAAGQTIALPPPPRPSDAMGATYIPTGGGTYGEGVGIPGLGNADPAMPAGTQSSWHMVTPQS
GTDTSATTPLDDVVARDRLYTSAQSRGLSNASSTMSGSSIPPEVAAQWPIDTVLIWLAQNQFSKDWQETFKGLNL
HGAQFLELGSLHGGRGNFGMMHQRVYPRLAQECANSGSGWDQPREREEGKRMRRLIRSIVTGKPVDPSKLNSSHG
RKESVTSGHSNNLPSAGTDPADSPNTPLNPVEAGFSARRYSQSRATTSLPTLNNSTMSSESNHRLALKHIDTEPG
KRLSPIANELAEGGSFWDIAARADSPGGSPGPQPSRLPPTTTPVLSTSNPGSAKLGHRSRNSTDSVSSSAAIYGS
GVPADAAIMLSRGFNFTDPAPSGRQAPDGRSKNSSVDSGERSAGLEGTISGKEPKSFLGFLSRLKKQKEDGSFAS
PDEYSPESPVMHKPSSLGYRATGGSDTNLDRPSSSFGIQGHDSYSSHPGTRPAGKVRTYVLATMDHYNFRMCDIT
EADSAAQIRHCICANLGLPDSGGFSIYVTELGKVDHAEPLDDQQLLINKRVRADSSGALKFFVAPGKSAAGRVDG
GVPASLSPGYLPPGMDEEAYARLNGRQRSSSSPPTSRSNTLSDDRLDEQTLARASEYRAEIERKQRKYLAKRKQA
ANRKDSPTASEATTPYGIVGQFVDFDQPRPSPFEDKRPDQLFPQRKPPAPPSDPSATLIKANSLSRKTGLGFPTS
SSSPDGYASSRHPPSMGSADADSLDGTSRVKLAAQMPGATGGIGTILAGIGRNLGAIGQSSVTSPRAASPSRMLP
SSAAHANGGGGSSQSGHHRPSTPGDVSPSTMKATTRSADAPSRPRSYGPHLDFEESDVSFANPAAEAGAAAAGAG
QRAPQDDDSDDDSDDGLFAIPLSGRAKGKAADETGQQRHRPSLTLMTPRSRGKQLSVSFTSPQSLGSAATAESND
GHSSSRTGAGSRRTPATPGPDGWDSEDRDSRINRRKSFIEKDVWANRPPTDDLLNNLDDFFPNLDLDQPVLEDGL
SGEAVSSPIPEAEELPEPMSPSVAVVAAVTGMPGSADGLGPSTAAAGGQSLRPLSMYSDGDTLGSDESTLKASEQ
QRTGSVQAMAVAHRSLRRSGGLGRMKSIREVARGAHEANKRFTTASQSVGKASSNIMRRKSTKMFNANIVQIRPD
QRGSMVMPQIPQDTLPKRQTTFRWFKGQLIGKGTYGRVYLGMNATTGEFLAVKEVEVNPKAAGGDKGKMREMVAA
LDQEIDTMQHLDHVNIVQYLGCERKEASISIFLEYISGGSIGSCLRKHGKFEESVVSSLTQQTLSGLAYLHREGI
LHRDLKADNILLDLDGTCKISDFGISKKTDNIYGNDKTNSMQGSVFWMAPEVVRSQGEGYSAKVDIWSLGCVVLE
MFAGRRPWSKDEAVGAIYKIANGETPPIPEDIQETIGPLAVAFMMDCFQVNPFDRPTADVLLSQHPFCDLDPNYN
FFDTELYTKIKETYKN*
Coding >Hirsu2|4824
ATGGCAGCACCGCCGCTGAGCAACATCATGAGCATCCCGCCGCCGCCGCCGCCGCCGCTCCCGAGGTATCCCGCT
CCCGCCCCCGGCGGCATCATCCCGCCTCCGCCCGCCGGGCCGCCGCCCGCCCTTCCTCCCGCCAACGCGCTCGGT
CCGCAGCCGTCGTGGCACGGCAACTACGGGCGCGTGTACGATGGACGCTCGGCCGTGCCGCTGCCCATGCCGCAC
CAGCACCACCAGCCCTATAACCCCAAGCTCCACGCCCAGATGGCTGCCGGACAGACCATCGCCCTCCCGCCGCCG
CCCCGGCCGAGCGACGCCATGGGCGCCACCTACATCCCGACCGGCGGCGGCACCTACGGCGAGGGCGTCGGCATC
CCGGGCCTGGGCAACGCCGACCCGGCCATGCCTGCCGGCACCCAGAGCTCGTGGCACATGGTGACGCCGCAGAGC
GGCACCGACACGAGCGCTACCACGCCCCTCGACGACGTCGTCGCCCGTGACCGGCTCTACACCAGCGCCCAGTCC
CGCGGCCTGTCCAACGCATCGAGCACCATGTCCGGCAGCTCCATCCCGCCCGAGGTCGCCGCCCAGTGGCCCATC
GACACCGTCCTGATATGGCTGGCCCAGAACCAGTTCTCCAAGGACTGGCAGGAGACCTTCAAGGGGCTCAACCTG
CACGGCGCCCAGTTCCTCGAGCTCGGCAGCCTTCACGGCGGCCGCGGCAACTTCGGCATGATGCACCAGAGGGTC
TACCCGCGCCTGGCCCAGGAGTGCGCCAACAGCGGCTCTGGCTGGGACCAGCCGCGCGAGCGCGAGGAGGGCAAG
CGCATGAGGCGCCTCATCCGGAGTATCGTCACGGGAAAACCCGTCGACCCCTCCAAGCTGAACAGCTCTCATGGC
CGCAAGGAGTCCGTCACCTCCGGCCACAGCAACAATCTACCCAGCGCCGGCACCGACCCGGCAGACTCGCCCAAC
ACTCCCCTGAACCCGGTGGAGGCGGGCTTCTCCGCGAGGCGGTATTCCCAGTCTCGAGCGACGACGAGCCTGCCC
ACTCTCAATAACAGCACCATGAGCTCCGAGTCCAATCACCGCCTGGCCCTGAAGCACATAGACACAGAGCCCGGC
AAACGTCTGAGCCCGATCGCAAACGAGCTTGCCGAGGGAGGCTCGTTCTGGGACATTGCCGCGCGGGCAGACAGT
CCGGGCGGCAGCCCGGGGCCCCAGCCGAGCCGCCTCCCGCCAACCACGACACCCGTCCTTTCCACCTCCAACCCC
GGCTCGGCCAAGCTGGGACACCGTTCCCGCAACAGCACCGACTCGGTCTCCTCCAGCGCCGCCATCTACGGGTCC
GGCGTGCCGGCCGACGCCGCCATCATGCTCTCTCGCGGATTCAACTTCACCGATCCCGCCCCCTCGGGGAGACAG
GCGCCCGACGGGCGGTCTAAAAACTCGTCCGTTGACTCTGGCGAGAGGTCGGCCGGCCTGGAGGGCACCATCTCG
GGCAAGGAGCCCAAGAGCTTTCTCGGCTTCCTCTCCCGCCTCAAGAAGCAGAAGGAGGACGGCTCGTTTGCGTCT
CCGGACGAGTACTCTCCCGAATCGCCCGTCATGCACAAGCCGTCGTCCCTGGGGTATCGCGCCACGGGCGGCAGC
GACACCAACCTGGACCGTCCGAGCTCCAGTTTCGGCATCCAGGGCCACGACTCGTACTCCTCGCACCCGGGGACC
AGGCCGGCCGGCAAGGTCAGGACCTACGTGCTCGCAACCATGGACCACTACAACTTCCGCATGTGCGACATCACC
GAGGCGGATTCCGCGGCCCAGATACGCCACTGCATCTGCGCGAACCTAGGCCTGCCAGACTCGGGCGGCTTCTCC
ATCTACGTCACGGAGCTCGGCAAGGTCGACCACGCGGAGCCGCTGGACGACCAGCAACTCCTCATCAACAAGCGC
GTGCGGGCCGACTCTTCCGGGGCACTCAAGTTCTTCGTCGCCCCCGGCAAGAGCGCAGCCGGGAGAGTCGACGGC
GGGGTGCCGGCGTCGCTCTCTCCGGGGTATCTTCCCCCGGGGATGGACGAGGAGGCTTACGCCCGCCTCAACGGC
CGGCAACGGTCAAGCTCGTCGCCGCCGACGTCGAGGTCGAACACACTGTCGGACGACAGGCTCGACGAGCAGACC
CTGGCCCGCGCGAGCGAGTACCGGGCGGAGATTGAGCGGAAACAGAGGAAATACCTCGCCAAGAGGAAGCAGGCG
GCGAACAGGAAGGACAGCCCGACAGCCTCCGAGGCCACCACGCCGTACGGGATTGTCGGCCAGTTCGTCGACTTT
GACCAGCCGAGACCCTCGCCATTCGAGGACAAGCGGCCGGACCAGCTCTTCCCGCAGCGAAAGCCGCCGGCGCCC
CCGAGCGACCCGTCCGCGACCCTGATCAAGGCGAACTCTTTGAGCAGAAAAACCGGGCTAGGATTCCCAACGTCG
AGCTCGAGCCCGGACGGCTACGCGTCATCAAGACACCCCCCGTCCATGGGGTCTGCGGACGCCGACAGCCTGGAC
GGCACTTCGAGGGTCAAGCTGGCGGCCCAGATGCCCGGCGCCACGGGCGGCATCGGCACCATACTCGCGGGCATA
GGAAGAAACCTCGGGGCCATCGGCCAGTCGTCGGTCACGAGCCCCCGAGCGGCATCGCCCAGCCGGATGCTGCCC
TCATCGGCGGCCCACGCCAACGGCGGCGGCGGCTCGTCGCAGTCAGGACACCACCGCCCATCGACGCCGGGCGAC
GTGAGTCCCAGCACGATGAAGGCGACGACGCGCTCTGCCGACGCGCCGTCCAGGCCCAGGTCGTACGGGCCGCAC
CTGGACTTCGAAGAGTCCGACGTCAGCTTCGCCAACCCGGCGGCGGAGGCGGGGGCGGCAGCGGCGGGAGCGGGC
CAGCGCGCGCCGCAAGACGACGACAGCGACGACGATTCCGACGACGGCCTGTTCGCCATCCCGCTCAGCGGCAGG
GCCAAGGGCAAGGCGGCGGACGAGACGGGCCAGCAGCGCCACCGGCCGAGCCTGACGCTGATGACGCCGCGGTCC
AGGGGCAAGCAGCTGTCGGTGTCGTTCACGTCGCCGCAGTCGCTCGGCAGCGCTGCCACGGCCGAGAGCAATGAC
GGCCACAGCAGCTCGAGGACGGGGGCCGGCTCGCGGAGGACGCCGGCGACGCCGGGCCCCGACGGCTGGGACTCG
GAAGACCGGGACAGCAGGATCAACCGGCGCAAGTCGTTCATCGAGAAGGACGTGTGGGCGAACCGGCCGCCGACG
GACGACCTGCTCAACAACCTCGACGACTTCTTCCCGAACCTGGACTTGGACCAGCCGGTGCTGGAGGACGGGCTG
AGCGGCGAGGCGGTGTCGTCGCCGATCCCGGAGGCGGAGGAATTGCCGGAGCCGATGAGCCCGTCGGTGGCGGTG
GTGGCGGCGGTGACGGGGATGCCGGGCAGCGCGGACGGCCTGGGCCCGTCGACGGCGGCGGCAGGCGGGCAGTCA
CTGCGGCCGCTGTCGATGTACAGCGACGGCGACACGCTGGGGTCGGACGAGTCGACACTCAAGGCGTCGGAGCAG
CAGCGCACAGGGTCGGTGCAGGCGATGGCGGTGGCGCACAGGAGCCTGCGGCGGTCGGGCGGGCTGGGGCGGATG
AAGTCGATCCGCGAGGTGGCGCGCGGGGCGCACGAGGCCAACAAGCGGTTCACGACGGCGTCGCAGAGCGTGGGC
AAGGCGAGCAGCAACATCATGCGGCGCAAGAGCACCAAGATGTTCAACGCCAACATCGTGCAGATCCGGCCGGAT
CAGCGCGGCAGCATGGTGATGCCGCAGATACCGCAGGACACGCTGCCGAAGCGGCAGACGACGTTCCGCTGGTTC
AAGGGCCAGCTGATCGGCAAGGGGACGTACGGGCGGGTGTACCTGGGCATGAACGCGACGACAGGCGAGTTTTTG
GCGGTCAAGGAGGTCGAGGTCAACCCGAAGGCGGCCGGGGGCGACAAGGGCAAGATGCGGGAGATGGTGGCGGCG
CTGGACCAGGAGATCGACACGATGCAGCACCTGGACCACGTCAACATCGTGCAGTACCTGGGGTGCGAGCGCAAG
GAGGCGAGCATCAGCATCTTCCTCGAGTACATCTCGGGCGGCAGCATCGGGTCCTGCCTGCGCAAGCACGGCAAG
TTCGAGGAGTCGGTGGTCTCGTCGCTGACGCAGCAGACGCTGTCGGGGCTGGCGTACCTGCACCGCGAGGGCATC
CTGCACCGCGACCTCAAGGCGGACAACATCCTGCTGGACCTGGACGGGACGTGCAAGATCAGCGACTTTGGCATC
TCGAAGAAGACGGACAACATCTACGGCAACGACAAGACCAACTCGATGCAGGGCTCCGTCTTCTGGATGGCGCCC
GAGGTGGTGCGGTCGCAGGGCGAGGGCTACAGCGCCAAGGTGGACATCTGGAGCCTGGGCTGCGTCGTGCTCGAG
ATGTTCGCCGGGCGGCGGCCGTGGAGCAAGGACGAGGCGGTCGGGGCCATCTACAAGATTGCCAACGGGGAGACG
CCGCCGATTCCGGAGGACATCCAGGAGACGATTGGGCCGCTGGCGGTGGCGTTTATGATGGACTGCTTCCAGGTG
AACCCGTTCGACCGGCCGACGGCAGACGTGCTACTCTCGCAACATCCCTTTTGCGACTTGGACCCCAACTACAAC
TTCTTCGACACGGAACTGTACACGAAGATCAAGGAGACATACAAGAACTAG
Transcript >Hirsu2|4824
ATGGCAGCACCGCCGCTGAGCAACATCATGAGCATCCCGCCGCCGCCGCCGCCGCCGCTCCCGAGGTATCCCGCT
CCCGCCCCCGGCGGCATCATCCCGCCTCCGCCCGCCGGGCCGCCGCCCGCCCTTCCTCCCGCCAACGCGCTCGGT
CCGCAGCCGTCGTGGCACGGCAACTACGGGCGCGTGTACGATGGACGCTCGGCCGTGCCGCTGCCCATGCCGCAC
CAGCACCACCAGCCCTATAACCCCAAGCTCCACGCCCAGATGGCTGCCGGACAGACCATCGCCCTCCCGCCGCCG
CCCCGGCCGAGCGACGCCATGGGCGCCACCTACATCCCGACCGGCGGCGGCACCTACGGCGAGGGCGTCGGCATC
CCGGGCCTGGGCAACGCCGACCCGGCCATGCCTGCCGGCACCCAGAGCTCGTGGCACATGGTGACGCCGCAGAGC
GGCACCGACACGAGCGCTACCACGCCCCTCGACGACGTCGTCGCCCGTGACCGGCTCTACACCAGCGCCCAGTCC
CGCGGCCTGTCCAACGCATCGAGCACCATGTCCGGCAGCTCCATCCCGCCCGAGGTCGCCGCCCAGTGGCCCATC
GACACCGTCCTGATATGGCTGGCCCAGAACCAGTTCTCCAAGGACTGGCAGGAGACCTTCAAGGGGCTCAACCTG
CACGGCGCCCAGTTCCTCGAGCTCGGCAGCCTTCACGGCGGCCGCGGCAACTTCGGCATGATGCACCAGAGGGTC
TACCCGCGCCTGGCCCAGGAGTGCGCCAACAGCGGCTCTGGCTGGGACCAGCCGCGCGAGCGCGAGGAGGGCAAG
CGCATGAGGCGCCTCATCCGGAGTATCGTCACGGGAAAACCCGTCGACCCCTCCAAGCTGAACAGCTCTCATGGC
CGCAAGGAGTCCGTCACCTCCGGCCACAGCAACAATCTACCCAGCGCCGGCACCGACCCGGCAGACTCGCCCAAC
ACTCCCCTGAACCCGGTGGAGGCGGGCTTCTCCGCGAGGCGGTATTCCCAGTCTCGAGCGACGACGAGCCTGCCC
ACTCTCAATAACAGCACCATGAGCTCCGAGTCCAATCACCGCCTGGCCCTGAAGCACATAGACACAGAGCCCGGC
AAACGTCTGAGCCCGATCGCAAACGAGCTTGCCGAGGGAGGCTCGTTCTGGGACATTGCCGCGCGGGCAGACAGT
CCGGGCGGCAGCCCGGGGCCCCAGCCGAGCCGCCTCCCGCCAACCACGACACCCGTCCTTTCCACCTCCAACCCC
GGCTCGGCCAAGCTGGGACACCGTTCCCGCAACAGCACCGACTCGGTCTCCTCCAGCGCCGCCATCTACGGGTCC
GGCGTGCCGGCCGACGCCGCCATCATGCTCTCTCGCGGATTCAACTTCACCGATCCCGCCCCCTCGGGGAGACAG
GCGCCCGACGGGCGGTCTAAAAACTCGTCCGTTGACTCTGGCGAGAGGTCGGCCGGCCTGGAGGGCACCATCTCG
GGCAAGGAGCCCAAGAGCTTTCTCGGCTTCCTCTCCCGCCTCAAGAAGCAGAAGGAGGACGGCTCGTTTGCGTCT
CCGGACGAGTACTCTCCCGAATCGCCCGTCATGCACAAGCCGTCGTCCCTGGGGTATCGCGCCACGGGCGGCAGC
GACACCAACCTGGACCGTCCGAGCTCCAGTTTCGGCATCCAGGGCCACGACTCGTACTCCTCGCACCCGGGGACC
AGGCCGGCCGGCAAGGTCAGGACCTACGTGCTCGCAACCATGGACCACTACAACTTCCGCATGTGCGACATCACC
GAGGCGGATTCCGCGGCCCAGATACGCCACTGCATCTGCGCGAACCTAGGCCTGCCAGACTCGGGCGGCTTCTCC
ATCTACGTCACGGAGCTCGGCAAGGTCGACCACGCGGAGCCGCTGGACGACCAGCAACTCCTCATCAACAAGCGC
GTGCGGGCCGACTCTTCCGGGGCACTCAAGTTCTTCGTCGCCCCCGGCAAGAGCGCAGCCGGGAGAGTCGACGGC
GGGGTGCCGGCGTCGCTCTCTCCGGGGTATCTTCCCCCGGGGATGGACGAGGAGGCTTACGCCCGCCTCAACGGC
CGGCAACGGTCAAGCTCGTCGCCGCCGACGTCGAGGTCGAACACACTGTCGGACGACAGGCTCGACGAGCAGACC
CTGGCCCGCGCGAGCGAGTACCGGGCGGAGATTGAGCGGAAACAGAGGAAATACCTCGCCAAGAGGAAGCAGGCG
GCGAACAGGAAGGACAGCCCGACAGCCTCCGAGGCCACCACGCCGTACGGGATTGTCGGCCAGTTCGTCGACTTT
GACCAGCCGAGACCCTCGCCATTCGAGGACAAGCGGCCGGACCAGCTCTTCCCGCAGCGAAAGCCGCCGGCGCCC
CCGAGCGACCCGTCCGCGACCCTGATCAAGGCGAACTCTTTGAGCAGAAAAACCGGGCTAGGATTCCCAACGTCG
AGCTCGAGCCCGGACGGCTACGCGTCATCAAGACACCCCCCGTCCATGGGGTCTGCGGACGCCGACAGCCTGGAC
GGCACTTCGAGGGTCAAGCTGGCGGCCCAGATGCCCGGCGCCACGGGCGGCATCGGCACCATACTCGCGGGCATA
GGAAGAAACCTCGGGGCCATCGGCCAGTCGTCGGTCACGAGCCCCCGAGCGGCATCGCCCAGCCGGATGCTGCCC
TCATCGGCGGCCCACGCCAACGGCGGCGGCGGCTCGTCGCAGTCAGGACACCACCGCCCATCGACGCCGGGCGAC
GTGAGTCCCAGCACGATGAAGGCGACGACGCGCTCTGCCGACGCGCCGTCCAGGCCCAGGTCGTACGGGCCGCAC
CTGGACTTCGAAGAGTCCGACGTCAGCTTCGCCAACCCGGCGGCGGAGGCGGGGGCGGCAGCGGCGGGAGCGGGC
CAGCGCGCGCCGCAAGACGACGACAGCGACGACGATTCCGACGACGGCCTGTTCGCCATCCCGCTCAGCGGCAGG
GCCAAGGGCAAGGCGGCGGACGAGACGGGCCAGCAGCGCCACCGGCCGAGCCTGACGCTGATGACGCCGCGGTCC
AGGGGCAAGCAGCTGTCGGTGTCGTTCACGTCGCCGCAGTCGCTCGGCAGCGCTGCCACGGCCGAGAGCAATGAC
GGCCACAGCAGCTCGAGGACGGGGGCCGGCTCGCGGAGGACGCCGGCGACGCCGGGCCCCGACGGCTGGGACTCG
GAAGACCGGGACAGCAGGATCAACCGGCGCAAGTCGTTCATCGAGAAGGACGTGTGGGCGAACCGGCCGCCGACG
GACGACCTGCTCAACAACCTCGACGACTTCTTCCCGAACCTGGACTTGGACCAGCCGGTGCTGGAGGACGGGCTG
AGCGGCGAGGCGGTGTCGTCGCCGATCCCGGAGGCGGAGGAATTGCCGGAGCCGATGAGCCCGTCGGTGGCGGTG
GTGGCGGCGGTGACGGGGATGCCGGGCAGCGCGGACGGCCTGGGCCCGTCGACGGCGGCGGCAGGCGGGCAGTCA
CTGCGGCCGCTGTCGATGTACAGCGACGGCGACACGCTGGGGTCGGACGAGTCGACACTCAAGGCGTCGGAGCAG
CAGCGCACAGGGTCGGTGCAGGCGATGGCGGTGGCGCACAGGAGCCTGCGGCGGTCGGGCGGGCTGGGGCGGATG
AAGTCGATCCGCGAGGTGGCGCGCGGGGCGCACGAGGCCAACAAGCGGTTCACGACGGCGTCGCAGAGCGTGGGC
AAGGCGAGCAGCAACATCATGCGGCGCAAGAGCACCAAGATGTTCAACGCCAACATCGTGCAGATCCGGCCGGAT
CAGCGCGGCAGCATGGTGATGCCGCAGATACCGCAGGACACGCTGCCGAAGCGGCAGACGACGTTCCGCTGGTTC
AAGGGCCAGCTGATCGGCAAGGGGACGTACGGGCGGGTGTACCTGGGCATGAACGCGACGACAGGCGAGTTTTTG
GCGGTCAAGGAGGTCGAGGTCAACCCGAAGGCGGCCGGGGGCGACAAGGGCAAGATGCGGGAGATGGTGGCGGCG
CTGGACCAGGAGATCGACACGATGCAGCACCTGGACCACGTCAACATCGTGCAGTACCTGGGGTGCGAGCGCAAG
GAGGCGAGCATCAGCATCTTCCTCGAGTACATCTCGGGCGGCAGCATCGGGTCCTGCCTGCGCAAGCACGGCAAG
TTCGAGGAGTCGGTGGTCTCGTCGCTGACGCAGCAGACGCTGTCGGGGCTGGCGTACCTGCACCGCGAGGGCATC
CTGCACCGCGACCTCAAGGCGGACAACATCCTGCTGGACCTGGACGGGACGTGCAAGATCAGCGACTTTGGCATC
TCGAAGAAGACGGACAACATCTACGGCAACGACAAGACCAACTCGATGCAGGGCTCCGTCTTCTGGATGGCGCCC
GAGGTGGTGCGGTCGCAGGGCGAGGGCTACAGCGCCAAGGTGGACATCTGGAGCCTGGGCTGCGTCGTGCTCGAG
ATGTTCGCCGGGCGGCGGCCGTGGAGCAAGGACGAGGCGGTCGGGGCCATCTACAAGATTGCCAACGGGGAGACG
CCGCCGATTCCGGAGGACATCCAGGAGACGATTGGGCCGCTGGCGGTGGCGTTTATGATGGACTGCTTCCAGGTG
AACCCGTTCGACCGGCCGACGGCAGACGTGCTACTCTCGCAACATCCCTTTTGCGACTTGGACCCCAACTACAAC
TTCTTCGACACGGAACTGTACACGAAGATCAAGGAGACATACAAGAACTAG
Gene >Hirsu2|4824
ATGGCAGCACCGCCGCTGAGCAACATCATGAGCATCCCGCCGCCGCCGCCGCCGCCGCTCCCGAGGTATCCCGCT
CCCGCCCCCGGCGGCATCATCCCGCCTCCGCCCGCCGGGCCGCCGCCCGCCCTTCCTCCCGCCAACGCGCTCGGT
CCGCAGCCGTCGTGGCACGGCAACTACGGGCGCGTGTACGATGGACGCTCGGCCGTGCCGCTGCCCATGCCGCAC
CAGCACCACCAGCCCTATAACCCCAAGCTCCACGCCCAGATGGCTGCCGGACAGACCATCGCCCTCCCGCCGCCG
CCCCGGCCGAGCGACGCCATGGGCGCCACCTACATCCCGACCGGCGGCGGCACCTACGGCGAGGGCGTCGGCATC
CCGGGCCTGGGCAACGCCGACCCGGCCATGCCTGCCGGCACCCAGAGCTCGTGGCACATGGTGACGCCGCAGAGC
GGCACCGACACGAGCGCTACCACGCCCCTCGACGACGTCGTCGCCCGTGACCGGCTCTACACCAGCGCCCAGTCC
CGCGGCCTGTCCAACGCATCGAGCACCATGTCCGGCAGCTCCATCCCGCCCGAGGTCGCCGCCCAGTGGCCCATC
GACACCGTCCTGATATGGCTGGCCCAGAACCAGTTCTCCAAGGACTGGCAGGAGACCTTCAAGGGGCTCAACCTG
CACGGCGCCCAGTTCCTCGAGCTCGGCAGCCTTCACGGCGGCCGCGGCAACTTCGGCATGATGCACCAGAGGGTC
TACCCGCGCCTGGCCCAGGAGTGCGCCAACAGCGGCTCTGGCTGGGACCAGCCGCGCGAGCGCGAGGAGGGCAAG
CGCATGAGGCGCCTCATCCGGAGTATCGTCACGGGAAAACCCGTCGACCCCTCCAAGCTGAACAGCTCTCATGGC
CGCAAGGAGTCCGTCACCTCCGGCCACAGCAACAATCTACCCAGCGCCGGCACCGACCCGGCAGACTCGCCCAAC
GTGAGTACCCCCCCTTCTTCGCCCGACGCGGCGTCCGAATTCCTTTCCACTGACAGGCAGACGTCTCGACAGACT
CCCCTGAACCCGGTGGAGGCGGGCTTCTCCGCGAGGCGGTATTCCCAGTCTCGAGCGACGACGAGCCTGCCCACT
CTCAATAACAGCACCATGAGCTCCGAGTCCAATCACCGCCTGGCCCTGAAGCACATAGACACAGAGCCCGGCAAA
CGTCTGAGCCCGATCGCAAACGAGCTTGCCGAGGGAGGCTCGTTCTGGGACATTGCCGCGCGGGCAGACAGTCCG
GGCGGCAGCCCGGGGCCCCAGCCGAGCCGCCTCCCGCCAACCACGACACCCGTCCTTTCCACCTCCAACCCCGGC
TCGGCCAAGCTGGGACACCGTTCCCGCAACAGCACCGACTCGGTCTCCTCCAGCGCCGCCATCTACGGGTCCGGC
GTGCCGGCCGACGCCGCCATCATGCTCTCTCGCGGATTCAACTTCACCGATCCCGCCCCCTCGGGGAGACAGGCG
CCCGACGGGCGGTCTAAAAACTCGTCCGTTGACTCTGGCGAGAGGTCGGCCGGCCTGGAGGGCACCATCTCGGGC
AAGGAGCCCAAGAGCTTTCTCGGCTTCCTCTCCCGCCTCAAGAAGCAGAAGGAGGACGGCTCGTTTGCGTCTCCG
GACGAGTACTCTCCCGAATCGCCCGTCATGCACAAGCCGTCGTCCCTGGGGTATCGCGCCACGGGCGGCAGCGAC
ACCAACCTGGACCGTCCGAGCTCCAGTTTCGGCATCCAGGGCCACGACTCGTACTCCTCGCACCCGGGGACCAGG
CCGGCCGGCAAGGTCAGGACCTACGTGCTCGCAACCATGGACCACTACAACTTCCGCATGTGCGACATCACCGAG
GCGGATTCCGCGGCCCAGATACGCCACTGCATCTGCGCGAACCTAGGCCTGCCAGACTCGGGCGGCTTCTCCATC
TACGTCACGGAGCTCGGCAAGGTCGACCACGCGGAGCCGCTGGACGACCAGCAACTCCTCATCAACAAGCGCGTG
CGGGCCGACTCTTCCGGGGCACTCAAGTTCTTCGTCGCCCCCGGCAAGAGCGCAGCCGGGAGAGTCGACGGCGGG
GTGCCGGCGTCGCTCTCTCCGGGGTATCTTCCCCCGGGGATGGACGAGGAGGCTTACGCCCGCCTCAACGGCCGG
CAACGGTCAAGCTCGTCGCCGCCGACGTCGAGGTCGAACACACTGTCGGACGACAGGCTCGACGAGCAGACCCTG
GCCCGCGCGAGCGAGTACCGGGCGGAGATTGAGCGGAAACAGAGGAAATACCTCGCCAAGAGGAAGCAGGCGGCG
AACAGGAAGGACAGCCCGACAGCCTCCGAGGCCACCACGCCGTACGGGATTGTCGGCCAGTTCGTCGACTTTGAC
CAGCCGAGACCCTCGCCATTCGAGGACAAGCGGCCGGACCAGCTCTTCCCGCAGCGAAAGCCGCCGGCGCCCCCG
AGCGACCCGTCCGCGACCCTGATCAAGGCGAACTCTTTGAGCAGAAAAACCGGGCTAGGATTCCCAACGTCGAGC
TCGAGCCCGGACGGCTACGCGTCATCAAGACACCCCCCGTCCATGGGGTCTGCGGACGCCGACAGCCTGGACGGC
ACTTCGAGGGTCAAGCTGGCGGCCCAGATGCCCGGCGCCACGGGCGGCATCGGCACCATACTCGCGGGCATAGGA
AGAAACCTCGGGGCCATCGGCCAGTCGTCGGTCACGAGCCCCCGAGCGGCATCGCCCAGCCGGATGCTGCCCTCA
TCGGCGGCCCACGCCAACGGCGGCGGCGGCTCGTCGCAGTCAGGTAAGAAGGCCTTGCCCAGCCACCAGTTCGGC
CAGCACGTCAAGGAAAGAAGCAGCTCCCGCTCCTCGGGCTCGCCGGGGACAGTGACGCGGGGCCCCGGGAACTTG
TCATTCATCGTCCCGGACTACTCGCCGGGGGGGACGCCTCTGTTCGCGGTCCAGACGCCGGACAGCGGATCAAGT
GCTAAACAGACTGATGCAGGACACCACCGCCCATCGACGCCGGGCGACGTGAGTCCCAGCACGATGAAGGCGACG
ACGCGCTCTGCCGACGCGCCGTCCAGGCCCAGGTCGTACGGGCCGCACCTGGACTTCGAAGAGTCCGACGTCAGC
TTCGCCAACCCGGCGGCGGAGGCGGGGGCGGCAGCGGCGGGAGCGGGCCAGCGCGCGCCGCAAGACGACGACAGC
GACGACGATTCCGACGACGGCCTGTTCGCCATCCCGCTCAGCGGCAGGGCCAAGGGCAAGGCGGCGGACGAGACG
GGCCAGCAGCGCCACCGGCCGAGCCTGACGCTGATGACGCCGCGGTCCAGGGGCAAGCAGCTGTCGGTGTCGTTC
ACGTCGCCGCAGTCGCTCGGCAGCGCTGCCACGGCCGAGAGCAATGACGGCCACAGCAGCTCGAGGACGGGGGCC
GGCTCGCGGAGGACGCCGGCGACGCCGGGCCCCGACGGCTGGGACTCGGAAGACCGGGACAGCAGGATCAACCGG
CGCAAGTCGTTCATCGAGAAGGACGTGTGGGCGAACCGGCCGCCGACGGACGACCTGCTCAACAACCTCGACGAC
TTCTTCCCGAACCTGGACTTGGACCAGCCGGTGCTGGAGGACGGGCTGAGCGGCGAGGCGGTGTCGTCGCCGATC
CCGGAGGCGGAGGAATTGCCGGAGCCGATGAGCCCGTCGGTGGCGGTGGTGGCGGCGGTGACGGGGATGCCGGGC
AGCGCGGACGGCCTGGGCCCGTCGACGGCGGCGGCAGGCGGGCAGTCACTGCGGCCGCTGTCGATGTACAGCGAC
GGCGACACGCTGGGGTCGGACGAGTCGACACTCAAGGCGTCGGAGCAGCAGCGCACAGGGTCGGTGCAGGCGATG
GCGGTGGCGCACAGGAGCCTGCGGCGGTCGGGCGGGCTGGGGCGGATGAAGTCGATCCGCGAGGTGGCGCGCGGG
GCGCACGAGGCCAACAAGCGGTTCACGACGGCGTCGCAGAGCGTGGGCAAGGCGAGCAGCAACATCATGCGGCGC
AAGAGCACCAAGATGTTCAACGCCAACATCGTGCAGATCCGGCCGGATCAGCGCGGCAGCATGGTGATGCCGCAG
ATACCGCAGGACACGCTGCCGAAGCGGCAGACGACGTTCCGCTGGTTCAAGGGCCAGCTGATCGGCAAGGGGACG
TACGGGCGGGTGTACCTGGGCATGAACGCGACGACAGGCGAGTTTTTGGCGGTCAAGGAGGTCGAGGTCAACCCG
AAGGCGGCCGGGGGCGACAAGGGCAAGATGCGGGAGATGGTGGCGGCGCTGGACCAGGAGATCGACACGATGCAG
CACCTGGACCACGTCAACATCGTGCAGTACCTGGGGTGCGAGCGCAAGGAGGCGAGCATCAGCATCTTCCTCGAG
TACATCTCGGGCGGCAGCATCGGGTCCTGCCTGCGCAAGCACGGCAAGTTCGAGGAGTCGGTGGTCTCGTCGCTG
ACGCAGCAGACGCTGTCGGGGCTGGCGTACCTGCACCGCGAGGGCATCCTGCACCGCGACCTCAAGGCGGACAAC
ATCCTGCTGGACCTGGACGGGACGTGCAAGATCAGCGACTTTGGCATCTCGAAGAAGACGGACAACATCTACGGC
AACGACAAGACCAACTCGATGCAGGGCTCCGTCTTCTGGATGGCGCCCGAGGTGGTGCGGTCGCAGGGCGAGGGC
TACAGCGCCAAGGTGGACATCTGGAGCCTGGGCTGCGTCGTGCTCGAGATGTTCGCCGGGCGGCGGCCGTGGAGC
AAGGACGAGGCGGTCGGGGCCATCTACAAGATTGCCAACGGGGAGACGCCGCCGATTCCGGAGGACATCCAGGAG
ACGATTGGGCCGCTGGCGGTGGCGTTTATGATGGACTGCTTCCAGGTGTACGTTTTTATCCCCCCCCCCAAAAAA
AAAATCCTGTCTTTCTTTGTCTCTCTGTCTCTGCGTCTCTGTTTTCTCCCCCTCGGTTCTGACCGCGCCAGCAGG
AACCCGTTCGACCGGCCGACGGCAGACGTGCTACTCTCGCAACATCCCTTTTGCGACTTGGACCCCAACTACAAC
TTCTTCGACACGGAACTGTACACGAAGATCAAGGAGACATACAAGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail