Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4816
Gene name
LocationContig_2428:49..2272
Strand+
Gene length (bp)2223
Transcript length (bp)2223
Coding sequence length (bp)2223
Protein length (aa) 741

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 9.7E-27 537 673

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 493 693 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 44 61 17
3 76 98 22
4 513 535 22
5 545 562 17
6 569 586 17
7 590 609 19
8 616 635 19
9 655 677 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4816
MAAAIASRTSMGSVVPAHAIVLVVFVGGALGFVGWVKQRLNQPLVNVASTLASIAIISVVTKEQSIQDGFFSGDK
ILQVLKMLLVGISFTVAVNLLVWRVSARHVLRASTATALACLGDRLSLIAKSFLDGSEDEVNSAAYGRTTAHYNS
AYDLMSKTLREAKLEYYFLGREAVYRLDKCLYKSVEALSQAVGGLRSALDTQFTLLKEVPAVAAASASASASASA
ARPVTPTPMSPGPPPSSPRLARALSALALHDDAREPLPVIQEAQDEPRAPLLRRRSDPSFGSPAFRAPSDIFALF
MALLGPSMKSLVYTLSEILRECPFDPVSMAEVTVNDQLQESLRDALALYNEARGNALRELYRSIELGRFRSEKIQ
ADIEEVAAACGHFSFTLQAVAEEMDSYLQVLSDLKRMTATGSRSWNWLKFWHRWRPLRRWRESWDDAETEALLPK
RPPPAPSTKPVGKMALPKGIPASMVRRRDSFSWDASPQASTALRRVSQWALTALRFLAREDITFGIKVGIGALLW
AASAFIPATRPVYQHWRGEWGLLSYMIVVGMTTGASNTTSTARFVGTLIGAACACVSWIASDDDPYLLALFGWLV
ACWNFYLILVRKNAPLGRISLLAYNVIVLYAYSLSQDVEDDDDDEGGTKPLILNITYHRVVAVTLGILWGMVVCR
LLWPISGRRKFREGLAVLYLQLGLIWRRGPLGVLIESDSTRDYMREGEQVALQRYGKHKAPFPPF*
Coding >Hirsu2|4816
ATGGCCGCCGCCATCGCCTCGCGCACCAGCATGGGCTCCGTCGTGCCGGCCCACGCCATCGTCCTCGTCGTCTTC
GTCGGCGGCGCCCTCGGCTTCGTCGGCTGGGTCAAGCAGCGGCTGAACCAGCCGCTCGTCAACGTCGCCTCCACC
CTCGCCTCCATCGCCATCATCTCCGTCGTCACCAAGGAGCAGTCCATCCAGGACGGCTTCTTCTCCGGCGACAAG
ATCCTCCAGGTCCTCAAGATGCTCCTCGTCGGCATCTCCTTCACCGTCGCCGTCAACCTGCTCGTCTGGCGCGTC
TCCGCCCGCCACGTCCTGCGCGCCTCCACCGCCACCGCCCTCGCCTGCCTCGGCGACCGCCTCTCGCTCATCGCC
AAGAGCTTCCTCGACGGCTCCGAGGACGAGGTCAACTCCGCCGCCTACGGCCGCACCACCGCCCACTACAACTCC
GCCTACGACCTCATGAGCAAGACGCTGCGCGAGGCCAAGCTCGAGTACTACTTCCTCGGCCGTGAGGCCGTCTAC
CGCCTCGACAAGTGCCTCTACAAGTCTGTCGAGGCCCTGTCCCAGGCCGTCGGCGGCCTGCGCAGCGCCCTCGAC
ACCCAGTTCACCCTGCTCAAGGAGGTCCCCGCCGTCGCCGCCGCCTCCGCCTCCGCCTCCGCCTCCGCCTCCGCC
GCCCGGCCCGTGACGCCGACGCCCATGTCGCCGGGCCCCCCGCCATCGTCGCCCAGGCTCGCGAGGGCCCTGTCC
GCCTTGGCCCTCCACGACGACGCCAGGGAGCCGCTGCCCGTCATCCAGGAGGCGCAGGACGAGCCGCGGGCGCCG
TTGCTGCGGCGGCGCTCGGATCCATCCTTCGGGTCGCCCGCCTTCCGGGCCCCGTCCGACATCTTCGCCCTCTTC
ATGGCCCTCCTGGGCCCATCCATGAAGTCGCTGGTCTACACCCTGTCGGAGATCTTGCGCGAGTGCCCCTTCGAC
CCCGTCTCCATGGCCGAGGTCACCGTCAACGACCAGCTCCAGGAGAGCCTGCGGGACGCGCTCGCGCTGTACAAC
GAGGCCCGGGGCAACGCGCTGCGCGAGCTGTACCGGAGCATAGAGCTGGGCCGGTTCCGGTCCGAGAAGATCCAG
GCCGACATCGAGGAGGTGGCGGCCGCCTGCGGGCACTTCTCCTTCACCCTCCAGGCCGTGGCCGAGGAGATGGAC
TCGTACCTGCAGGTGCTCAGCGACCTGAAGCGCATGACGGCCACCGGCAGCCGCAGCTGGAACTGGCTCAAGTTC
TGGCATCGCTGGAGGCCGCTCCGCAGGTGGCGCGAGTCGTGGGACGACGCGGAGACGGAGGCCCTGCTGCCGAAG
CGGCCGCCGCCGGCGCCGTCGACCAAGCCGGTCGGCAAGATGGCGCTGCCCAAGGGGATACCCGCGTCGATGGTG
CGGCGGCGGGACTCGTTCAGCTGGGACGCGTCGCCGCAGGCCAGCACGGCGCTGCGGCGCGTGTCGCAGTGGGCG
CTGACGGCGCTGCGCTTCCTGGCGCGCGAGGACATCACCTTCGGCATCAAGGTCGGCATCGGCGCCCTGCTGTGG
GCCGCGTCGGCCTTCATCCCGGCCACGCGGCCCGTGTACCAGCACTGGCGCGGCGAGTGGGGGCTGCTGTCGTAC
ATGATCGTCGTCGGCATGACGACGGGCGCGTCCAACACGACGTCGACGGCGCGCTTCGTCGGCACCCTGATCGGG
GCCGCGTGCGCGTGCGTGTCGTGGATCGCCAGCGATGACGACCCCTACCTGCTCGCCCTCTTCGGCTGGCTCGTC
GCCTGCTGGAACTTCTACCTGATCCTGGTGCGCAAGAACGCGCCGCTCGGCCGCATCTCGCTGCTGGCCTACAAC
GTCATCGTCCTCTACGCCTACAGCCTGTCGCAGGACGTCGAGGACGACGACGACGACGAGGGCGGCACCAAGCCG
CTCATCCTCAACATCACCTACCACCGCGTCGTCGCCGTCACCCTCGGCATCCTCTGGGGCATGGTCGTCTGCCGC
CTGCTGTGGCCCATCTCCGGCCGCCGCAAGTTCCGCGAGGGCCTGGCCGTGCTGTACCTCCAGCTCGGCCTCATC
TGGAGGCGCGGCCCGCTCGGCGTCCTGATCGAGAGCGACAGCACCCGCGACTACATGCGCGAGGGGGAGCAGGTC
GCCCTGCAGCGCTATGGTAAGCACAAGGCCCCCTTCCCCCCTTTTTGA
Transcript >Hirsu2|4816
ATGGCCGCCGCCATCGCCTCGCGCACCAGCATGGGCTCCGTCGTGCCGGCCCACGCCATCGTCCTCGTCGTCTTC
GTCGGCGGCGCCCTCGGCTTCGTCGGCTGGGTCAAGCAGCGGCTGAACCAGCCGCTCGTCAACGTCGCCTCCACC
CTCGCCTCCATCGCCATCATCTCCGTCGTCACCAAGGAGCAGTCCATCCAGGACGGCTTCTTCTCCGGCGACAAG
ATCCTCCAGGTCCTCAAGATGCTCCTCGTCGGCATCTCCTTCACCGTCGCCGTCAACCTGCTCGTCTGGCGCGTC
TCCGCCCGCCACGTCCTGCGCGCCTCCACCGCCACCGCCCTCGCCTGCCTCGGCGACCGCCTCTCGCTCATCGCC
AAGAGCTTCCTCGACGGCTCCGAGGACGAGGTCAACTCCGCCGCCTACGGCCGCACCACCGCCCACTACAACTCC
GCCTACGACCTCATGAGCAAGACGCTGCGCGAGGCCAAGCTCGAGTACTACTTCCTCGGCCGTGAGGCCGTCTAC
CGCCTCGACAAGTGCCTCTACAAGTCTGTCGAGGCCCTGTCCCAGGCCGTCGGCGGCCTGCGCAGCGCCCTCGAC
ACCCAGTTCACCCTGCTCAAGGAGGTCCCCGCCGTCGCCGCCGCCTCCGCCTCCGCCTCCGCCTCCGCCTCCGCC
GCCCGGCCCGTGACGCCGACGCCCATGTCGCCGGGCCCCCCGCCATCGTCGCCCAGGCTCGCGAGGGCCCTGTCC
GCCTTGGCCCTCCACGACGACGCCAGGGAGCCGCTGCCCGTCATCCAGGAGGCGCAGGACGAGCCGCGGGCGCCG
TTGCTGCGGCGGCGCTCGGATCCATCCTTCGGGTCGCCCGCCTTCCGGGCCCCGTCCGACATCTTCGCCCTCTTC
ATGGCCCTCCTGGGCCCATCCATGAAGTCGCTGGTCTACACCCTGTCGGAGATCTTGCGCGAGTGCCCCTTCGAC
CCCGTCTCCATGGCCGAGGTCACCGTCAACGACCAGCTCCAGGAGAGCCTGCGGGACGCGCTCGCGCTGTACAAC
GAGGCCCGGGGCAACGCGCTGCGCGAGCTGTACCGGAGCATAGAGCTGGGCCGGTTCCGGTCCGAGAAGATCCAG
GCCGACATCGAGGAGGTGGCGGCCGCCTGCGGGCACTTCTCCTTCACCCTCCAGGCCGTGGCCGAGGAGATGGAC
TCGTACCTGCAGGTGCTCAGCGACCTGAAGCGCATGACGGCCACCGGCAGCCGCAGCTGGAACTGGCTCAAGTTC
TGGCATCGCTGGAGGCCGCTCCGCAGGTGGCGCGAGTCGTGGGACGACGCGGAGACGGAGGCCCTGCTGCCGAAG
CGGCCGCCGCCGGCGCCGTCGACCAAGCCGGTCGGCAAGATGGCGCTGCCCAAGGGGATACCCGCGTCGATGGTG
CGGCGGCGGGACTCGTTCAGCTGGGACGCGTCGCCGCAGGCCAGCACGGCGCTGCGGCGCGTGTCGCAGTGGGCG
CTGACGGCGCTGCGCTTCCTGGCGCGCGAGGACATCACCTTCGGCATCAAGGTCGGCATCGGCGCCCTGCTGTGG
GCCGCGTCGGCCTTCATCCCGGCCACGCGGCCCGTGTACCAGCACTGGCGCGGCGAGTGGGGGCTGCTGTCGTAC
ATGATCGTCGTCGGCATGACGACGGGCGCGTCCAACACGACGTCGACGGCGCGCTTCGTCGGCACCCTGATCGGG
GCCGCGTGCGCGTGCGTGTCGTGGATCGCCAGCGATGACGACCCCTACCTGCTCGCCCTCTTCGGCTGGCTCGTC
GCCTGCTGGAACTTCTACCTGATCCTGGTGCGCAAGAACGCGCCGCTCGGCCGCATCTCGCTGCTGGCCTACAAC
GTCATCGTCCTCTACGCCTACAGCCTGTCGCAGGACGTCGAGGACGACGACGACGACGAGGGCGGCACCAAGCCG
CTCATCCTCAACATCACCTACCACCGCGTCGTCGCCGTCACCCTCGGCATCCTCTGGGGCATGGTCGTCTGCCGC
CTGCTGTGGCCCATCTCCGGCCGCCGCAAGTTCCGCGAGGGCCTGGCCGTGCTGTACCTCCAGCTCGGCCTCATC
TGGAGGCGCGGCCCGCTCGGCGTCCTGATCGAGAGCGACAGCACCCGCGACTACATGCGCGAGGGGGAGCAGGTC
GCCCTGCAGCGCTATGGTAAGCACAAGGCCCCCTTCCCCCCTTTTTGA
Gene >Hirsu2|4816
ATGGCCGCCGCCATCGCCTCGCGCACCAGCATGGGCTCCGTCGTGCCGGCCCACGCCATCGTCCTCGTCGTCTTC
GTCGGCGGCGCCCTCGGCTTCGTCGGCTGGGTCAAGCAGCGGCTGAACCAGCCGCTCGTCAACGTCGCCTCCACC
CTCGCCTCCATCGCCATCATCTCCGTCGTCACCAAGGAGCAGTCCATCCAGGACGGCTTCTTCTCCGGCGACAAG
ATCCTCCAGGTCCTCAAGATGCTCCTCGTCGGCATCTCCTTCACCGTCGCCGTCAACCTGCTCGTCTGGCGCGTC
TCCGCCCGCCACGTCCTGCGCGCCTCCACCGCCACCGCCCTCGCCTGCCTCGGCGACCGCCTCTCGCTCATCGCC
AAGAGCTTCCTCGACGGCTCCGAGGACGAGGTCAACTCCGCCGCCTACGGCCGCACCACCGCCCACTACAACTCC
GCCTACGACCTCATGAGCAAGACGCTGCGCGAGGCCAAGCTCGAGTACTACTTCCTCGGCCGTGAGGCCGTCTAC
CGCCTCGACAAGTGCCTCTACAAGTCTGTCGAGGCCCTGTCCCAGGCCGTCGGCGGCCTGCGCAGCGCCCTCGAC
ACCCAGTTCACCCTGCTCAAGGAGGTCCCCGCCGTCGCCGCCGCCTCCGCCTCCGCCTCCGCCTCCGCCTCCGCC
GCCCGGCCCGTGACGCCGACGCCCATGTCGCCGGGCCCCCCGCCATCGTCGCCCAGGCTCGCGAGGGCCCTGTCC
GCCTTGGCCCTCCACGACGACGCCAGGGAGCCGCTGCCCGTCATCCAGGAGGCGCAGGACGAGCCGCGGGCGCCG
TTGCTGCGGCGGCGCTCGGATCCATCCTTCGGGTCGCCCGCCTTCCGGGCCCCGTCCGACATCTTCGCCCTCTTC
ATGGCCCTCCTGGGCCCATCCATGAAGTCGCTGGTCTACACCCTGTCGGAGATCTTGCGCGAGTGCCCCTTCGAC
CCCGTCTCCATGGCCGAGGTCACCGTCAACGACCAGCTCCAGGAGAGCCTGCGGGACGCGCTCGCGCTGTACAAC
GAGGCCCGGGGCAACGCGCTGCGCGAGCTGTACCGGAGCATAGAGCTGGGCCGGTTCCGGTCCGAGAAGATCCAG
GCCGACATCGAGGAGGTGGCGGCCGCCTGCGGGCACTTCTCCTTCACCCTCCAGGCCGTGGCCGAGGAGATGGAC
TCGTACCTGCAGGTGCTCAGCGACCTGAAGCGCATGACGGCCACCGGCAGCCGCAGCTGGAACTGGCTCAAGTTC
TGGCATCGCTGGAGGCCGCTCCGCAGGTGGCGCGAGTCGTGGGACGACGCGGAGACGGAGGCCCTGCTGCCGAAG
CGGCCGCCGCCGGCGCCGTCGACCAAGCCGGTCGGCAAGATGGCGCTGCCCAAGGGGATACCCGCGTCGATGGTG
CGGCGGCGGGACTCGTTCAGCTGGGACGCGTCGCCGCAGGCCAGCACGGCGCTGCGGCGCGTGTCGCAGTGGGCG
CTGACGGCGCTGCGCTTCCTGGCGCGCGAGGACATCACCTTCGGCATCAAGGTCGGCATCGGCGCCCTGCTGTGG
GCCGCGTCGGCCTTCATCCCGGCCACGCGGCCCGTGTACCAGCACTGGCGCGGCGAGTGGGGGCTGCTGTCGTAC
ATGATCGTCGTCGGCATGACGACGGGCGCGTCCAACACGACGTCGACGGCGCGCTTCGTCGGCACCCTGATCGGG
GCCGCGTGCGCGTGCGTGTCGTGGATCGCCAGCGATGACGACCCCTACCTGCTCGCCCTCTTCGGCTGGCTCGTC
GCCTGCTGGAACTTCTACCTGATCCTGGTGCGCAAGAACGCGCCGCTCGGCCGCATCTCGCTGCTGGCCTACAAC
GTCATCGTCCTCTACGCCTACAGCCTGTCGCAGGACGTCGAGGACGACGACGACGACGAGGGCGGCACCAAGCCG
CTCATCCTCAACATCACCTACCACCGCGTCGTCGCCGTCACCCTCGGCATCCTCTGGGGCATGGTCGTCTGCCGC
CTGCTGTGGCCCATCTCCGGCCGCCGCAAGTTCCGCGAGGGCCTGGCCGTGCTGTACCTCCAGCTCGGCCTCATC
TGGAGGCGCGGCCCGCTCGGCGTCCTGATCGAGAGCGACAGCACCCGCGACTACATGCGCGAGGGGGAGCAGGTC
GCCCTGCAGCGCTATGGTAAGCACAAGGCCCCCTTCCCCCCTTTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail