Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4815
Gene name
LocationContig_2427:466..1423
Strand-
Gene length (bp)957
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Mitochondrial transit peptide 0.604 0.4226 0.3961 0.1815 0.6259 0.0145 0.3169 0.2859 0.1352 0.1034

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7765
Ophiocordyceps camponoti-rufipedis Ophun1|6973
Ophiocordyceps kimflemingae Ophio5|3432
Ophiocordyceps subramaniannii Hirsu2|4815 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5464
Ophiocordyceps subramaniannii Hirsu2|7643

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4815
MPKCRLCEGRCGAGGWYDEHGCGTQDFCEAFDGLKPRPASLRGFNGTKACFDAHKPRPNAVQPSAPGPSPTDDGG
PPPNPDDGPLPNPDDDGPRPSPDDDGPRPSPDXXXXXXXXXXXXXXXXXXXXXXXXTTDRCQTATGTGRLPSKDR
QGRPPSHQLLRQSNPPAEHLIQHIPSPNPIAPGSAPAMDACSHLRRSGTSHSFVQLGPHSRIVLMASAPSLCRSV
PDLRLRLRHATPRAAACSLDFPPGVDSCYVLAVSPLVDVCCVDSLRSRLRLSACPESLPSSWLSLPL*
Coding >Hirsu2|4815
ATGCCCAAGTGCAGACTCTGCGAGGGTCGATGCGGTGCTGGTGGCTGGTACGATGAGCACGGCTGCGGTACCCAG
GACTTCTGCGAAGCCTTTGACGGATTGAAGCCTAGGCCCGCCTCGCTCCGGGGCTTCAACGGCACCAAGGCGTGC
TTCGACGCCCACAAGCCTCGACCTAACGCGGTCCAGCCCTCCGCTCCTGGGCCTTCGCCTACCGACGATGGCGGG
CCGCCGCCGAACCCAGACGACGGACCGCTGCCAAACCCGGACGATGACGGACCTCGGCCGAGCCCGGACGATGAC
GGACCTCGGCCGAGCCCGGACGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNGACGACGGACCGCTGCCAAACAGCAACTGGAACGGGCCGTCTTCCAAGTAAGGACCGG
CAAGGAAGGCCTCCCAGCCATCAGCTGCTCCGGCAGTCAAACCCCCCAGCGGAGCATCTCATCCAGCACATCCCA
AGCCCAAATCCAATAGCCCCCGGTAGCGCTCCGGCCATGGATGCCTGCTCACACCTTCGCCGCAGCGGTACCTCA
CACTCGTTCGTCCAGCTTGGCCCACACTCGCGCATCGTGCTCATGGCATCCGCCCCGTCGCTCTGCCGCTCCGTT
CCTGACCTTCGTCTGCGGCTCCGGCATGCAACCCCGCGGGCAGCGGCTTGTAGTCTAGACTTTCCTCCTGGGGTG
GATAGCTGCTATGTGTTGGCAGTCTCTCCGCTTGTGGACGTGTGCTGCGTCGACTCTCTACGAAGTCGTCTGCGA
CTCTCGGCTTGTCCCGAGTCACTTCCCTCGTCATGGCTATCTCTCCCCTTGTAA
Transcript >Hirsu2|4815
ATGCCCAAGTGCAGACTCTGCGAGGGTCGATGCGGTGCTGGTGGCTGGTACGATGAGCACGGCTGCGGTACCCAG
GACTTCTGCGAAGCCTTTGACGGATTGAAGCCTAGGCCCGCCTCGCTCCGGGGCTTCAACGGCACCAAGGCGTGC
TTCGACGCCCACAAGCCTCGACCTAACGCGGTCCAGCCCTCCGCTCCTGGGCCTTCGCCTACCGACGATGGCGGG
CCGCCGCCGAACCCAGACGACGGACCGCTGCCAAACCCGGACGATGACGGACCTCGGCCGAGCCCGGACGATGAC
GGACCTCGGCCGAGCCCGGACGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNGACGACGGACCGCTGCCAAACAGCAACTGGAACGGGCCGTCTTCCAAGTAAGGACCGG
CAAGGAAGGCCTCCCAGCCATCAGCTGCTCCGGCAGTCAAACCCCCCAGCGGAGCATCTCATCCAGCACATCCCA
AGCCCAAATCCAATAGCCCCCGGTAGCGCTCCGGCCATGGATGCCTGCTCACACCTTCGCCGCAGCGGTACCTCA
CACTCGTTCGTCCAGCTTGGCCCACACTCGCGCATCGTGCTCATGGCATCCGCCCCGTCGCTCTGCCGCTCCGTT
CCTGACCTTCGTCTGCGGCTCCGGCATGCAACCCCGCGGGCAGCGGCTTGTAGTCTAGACTTTCCTCCTGGGGTG
GATAGCTGCTATGTGTTGGCAGTCTCTCCGCTTGTGGACGTGTGCTGCGTCGACTCTCTACGAAGTCGTCTGCGA
CTCTCGGCTTGTCCCGAGTCACTTCCCTCGTCATGGCTATCTCTCCCCTTGTAA
Gene >Hirsu2|4815
ATGCCCAAGTATTAAACACAGGCGCGAGAGGCAGAGGCAAAGGCAGGCACCGACTGAAGAACAGCATGACCGACA
AGGCGGCACAGGTGCAGACTCTGCGAGGGTCGATGCGGTGCTGGTGGCTGGTACGATGAGCACGGCTGCGGTACC
CAGGACTTCTGCGAAGCCTTTGACGGATTGAAGCCTAGGCCCGCCTCGCTCCGGGGCTTCAACGGCACCAAGGCG
TGCTTCGACGCCCACAAGCCTCGACCTAACGCGGTCCAGCCCTCCGCTCCTGGGCCTTCGCCTACCGACGATGGC
GGGCCGCCGCCGAACCCAGACGACGGACCGCTGCCAAACCCGGACGATGACGGACCTCGGCCGAGCCCGGACGAT
GACGGACCTCGGCCGAGCCCGGACGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNGACGACGGACCGCTGCCAAACAGCAACTGGAACGGGCCGTCTTCCAAGTAAGGAC
CGGCAAGGAAGGCCTCCCAGCCATCAGCTGCTCCGGCAGTCAAACCCCCCAGCGGAGCATCTCATCCAGCACATC
CCAAGCCCAAATCCAATAGCCCCCGGTAGCGCTCCGGCCATGGATGCCTGCTCACACCTTCGCCGCAGCGGTACC
TCACACTCGTTCGTCCAGCTTGGCCCACACTCGCGCATCGTGCTCATGGCATCCGCCCCGTCGCTCTGCCGCTCC
GTTCCTGACCTTCGTCTGCGGCTCCGGCATGCAACCCCGCGGGCAGCGGCTTGTAGTCTAGACTTTCCTCCTGGG
GTGGATAGCTGCTATGTGTTGGCAGTCTCTCCGCTTGTGGACGTGTGCTGCGTCGACTCTCTACGAAGTCGTCTG
CGACTCTCGGCTTGTCCCGAGTCACTTCCCTCGTCATGGCTATCTCTCCCCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail