Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|481
Gene name
LocationContig_1097:7906..9001
Strand-
Gene length (bp)1095
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.0E-10 4 81
PF00153 Mito_carr Mitochondrial carrier protein 4.8E-09 91 181
PF00153 Mito_carr Mitochondrial carrier protein 1.5E-17 204 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 5 291 1.0E-38
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 6 289 2.0E-37
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 5 298 4.0E-35
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 5 296 9.0E-35
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 5 291 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 5 291 1.0E-38
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 6 289 2.0E-37
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 5 298 4.0E-35
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 5 296 9.0E-35
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 5 291 1.0E-34
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 5 291 2.0E-34
sp|Q9VBN7|SAMC_DROME S-adenosylmethionine mitochondrial carrier protein homolog OS=Drosophila melanogaster GN=CG4743 PE=2 SV=2 5 288 1.0E-32
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 5 302 1.0E-32
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 5 288 4.0E-32
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 5 288 3.0E-31
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 4 298 8.0E-31
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 3 288 7.0E-30
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 5 297 5.0E-29
sp|O94344|YHMB_SCHPO Uncharacterized mitochondrial carrier C1271.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.11 PE=3 SV=1 5 301 4.0E-28
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 5 287 9.0E-26
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 5 269 3.0E-21
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 16 305 5.0E-21
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 5 269 2.0E-20
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 5 291 3.0E-19
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 51 301 1.0E-17
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 51 296 8.0E-17
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 48 298 2.0E-16
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 51 296 3.0E-16
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 51 296 3.0E-16
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 5 291 8.0E-16
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 4 273 1.0E-15
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 13 268 4.0E-15
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 4 273 6.0E-15
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 5 300 9.0E-15
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 5 306 1.0E-14
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 6 305 3.0E-14
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 5 291 3.0E-14
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 5 268 4.0E-14
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 6 298 4.0E-14
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 5 299 5.0E-14
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 1 273 7.0E-14
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 6 298 8.0E-14
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 6 298 1.0E-13
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 5 299 1.0E-13
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 5 298 2.0E-13
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 6 297 2.0E-13
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 5 306 2.0E-13
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 4 303 2.0E-13
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 18 274 4.0E-13
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 5 225 5.0E-13
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 1 273 5.0E-13
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 5 308 5.0E-13
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 6 297 6.0E-13
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 48 291 7.0E-13
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 5 303 1.0E-12
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 1 273 1.0E-12
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 6 274 1.0E-12
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 1 273 2.0E-12
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 5 229 2.0E-12
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 5 294 2.0E-12
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 4 273 4.0E-12
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 6 268 4.0E-12
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 4 301 6.0E-12
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 6 291 7.0E-12
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 5 268 1.0E-11
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 5 291 1.0E-11
sp|A5D9W9|S2538_PICGU Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 6 268 2.0E-11
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 5 294 3.0E-11
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 1 273 4.0E-11
sp|Q620A6|MFRN_CAEBR Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 15 283 4.0E-11
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 4 307 4.0E-11
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 4 268 8.0E-11
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 5 268 1.0E-10
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 6 294 1.0E-10
sp|Q4PDL5|S2538_USTMA Solute carrier family 25 member 38 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10880 PE=3 SV=2 7 298 2.0E-10
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 4 268 2.0E-10
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 5 268 3.0E-10
sp|Q23125|MFRN_CAEEL Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 6 283 3.0E-10
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 19 268 4.0E-10
sp|Q0CT66|S2538_ASPTN Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 4 288 4.0E-10
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 5 297 4.0E-10
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 5 297 5.0E-10
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 5 294 6.0E-10
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 5 294 6.0E-10
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 5 294 8.0E-10
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 4 306 9.0E-10
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 48 302 9.0E-10
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 5 294 1.0E-09
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 5 294 1.0E-09
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 5 294 1.0E-09
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 5 294 2.0E-09
sp|Q9H1U9|S2551_HUMAN Solute carrier family 25 member 51 OS=Homo sapiens GN=SLC25A51 PE=2 SV=1 1 269 3.0E-09
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 1 273 3.0E-09
sp|Q4WQC5|S2538_ASPFU Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 4 306 3.0E-09
sp|B0Y4J4|S2538_ASPFC Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 4 306 3.0E-09
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 5 293 5.0E-09
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 20 268 8.0E-09
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 20 268 1.0E-08
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 4 268 1.0E-08
sp|A2Q9F0|S2538_ASPNC Solute carrier family 25 member 38 homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g07650 PE=3 SV=1 4 295 1.0E-08
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 5 185 1.0E-08
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 4 268 2.0E-08
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 5 305 2.0E-08
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 4 268 4.0E-08
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 48 270 4.0E-08
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 48 297 4.0E-08
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 6 299 4.0E-08
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 5 297 5.0E-08
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 1 296 5.0E-08
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 17 304 6.0E-08
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 20 268 7.0E-08
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 19 227 7.0E-08
sp|Q52KK3|S2551_RAT Solute carrier family 25 member 51 OS=Rattus norvegicus GN=Slc25a51 PE=2 SV=1 4 269 7.0E-08
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 4 279 1.0E-07
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 1 296 1.0E-07
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 5 268 1.0E-07
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 51 268 2.0E-07
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 5 268 3.0E-07
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 5 268 3.0E-07
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 4 291 4.0E-07
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 5 236 4.0E-07
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 5 227 5.0E-07
sp|Q7DNC3|MPCP1_ARATH Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MPT1 PE=2 SV=1 5 223 5.0E-07
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 4 304 5.0E-07
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 20 227 5.0E-07
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 4 268 6.0E-07
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 1 268 6.0E-07
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 17 268 6.0E-07
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 4 268 7.0E-07
sp|P40035|PIC2_YEAST Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIC2 PE=1 SV=1 5 294 7.0E-07
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 2 186 8.0E-07
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 4 254 8.0E-07
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 20 268 1.0E-06
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 4 268 1.0E-06
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 5 236 1.0E-06
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 4 291 1.0E-06
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 6 291 1.0E-06
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 1 229 2.0E-06
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 20 268 2.0E-06
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 20 268 2.0E-06
sp|Q6BH02|S2538_DEBHA Solute carrier family 25 member 38 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G22418g PE=3 SV=1 5 268 2.0E-06
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 4 289 2.0E-06
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 106 268 2.0E-06
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 5 268 2.0E-06
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 20 268 2.0E-06
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 5 293 2.0E-06
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 8 292 2.0E-06
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 20 268 3.0E-06
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 4 227 3.0E-06
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 2 119 3.0E-06
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 4 291 3.0E-06
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 4 268 3.0E-06
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 1 274 3.0E-06
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 1 296 5.0E-06
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 6 274 7.0E-06
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 4 293 8.0E-06
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 5 194 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 194 216 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|481
MDVYVAGAVAAFTVDVLVYPLDTLKTRYQSQDYLKAYRSGSGGNALALAGLYQGIGIVVLATLPAAGVFFSTYER
AKTFLSGRLPGPEALVHSSASALAEVASCLVLAPAEVVKQNAQMLRRGTSSSSSSSSSTSMQAFRQLAGPGARRR
LFTGYTALVARNLPFTGLQFPVFEHLRTRLWESRERGRRRQPRGLVETGLIAGASAGTAGAVAAFLTTPGDVVKT
RMMVTAGGEGSGGGATGPRPKQGSWAVAKQVHRERGIRGLFRGGLFRSSWTALGSSLYLGSYDTAKLWLRRRKDG
REDDSISSL*
Coding >Hirsu2|481
ATGGACGTTTACGTGGCCGGAGCGGTGGCCGCCTTCACCGTCGACGTGCTCGTCTACCCGCTCGACACGCTCAAG
ACGCGCTACCAGAGCCAGGACTACCTCAAGGCCTACCGGTCCGGCTCTGGGGGCAATGCGCTGGCCCTGGCCGGC
CTGTACCAGGGCATCGGCATCGTCGTCTTGGCCACCCTGCCCGCAGCTGGTGTCTTCTTCTCCACCTACGAGAGG
GCAAAGACGTTCCTGTCGGGCCGGCTCCCCGGCCCCGAGGCCCTCGTGCACTCGTCCGCGTCGGCTCTGGCCGAG
GTCGCCTCGTGCCTGGTCTTGGCCCCCGCCGAGGTCGTCAAGCAGAATGCGCAGATGCTGCGGCGCGGCACCTCG
TCGTCATCGTCGTCGTCGTCGTCGACGTCGATGCAGGCGTTCCGACAGCTGGCGGGTCCCGGCGCCCGCCGCCGC
CTGTTCACCGGCTATACGGCCTTGGTCGCCAGGAACCTGCCCTTTACCGGCCTGCAGTTCCCCGTCTTTGAGCAT
CTCCGGACCCGGCTGTGGGAGTCGCGGGAGAGGGGGCGTCGCCGCCAGCCCCGTGGTCTTGTTGAGACGGGCCTG
ATCGCCGGGGCCAGCGCCGGGACGGCCGGCGCCGTCGCCGCTTTCCTCACAACGCCCGGCGACGTCGTTAAGACA
CGCATGATGGTGACTGCCGGGGGCGAAGGGAGCGGCGGCGGCGCGACGGGCCCCCGTCCCAAGCAGGGATCGTGG
GCGGTCGCCAAGCAGGTACACCGCGAGCGAGGCATCAGGGGCCTCTTCCGAGGGGGCCTCTTTCGCTCCAGCTGG
ACCGCCTTGGGCAGCTCGCTGTATCTCGGGTCGTACGATACGGCCAAGCTGTGGCTGAGGCGGAGGAAAGATGGG
CGAGAGGACGATTCGATTAGTAGTCTCTAA
Transcript >Hirsu2|481
ATGGACGTTTACGTGGCCGGAGCGGTGGCCGCCTTCACCGTCGACGTGCTCGTCTACCCGCTCGACACGCTCAAG
ACGCGCTACCAGAGCCAGGACTACCTCAAGGCCTACCGGTCCGGCTCTGGGGGCAATGCGCTGGCCCTGGCCGGC
CTGTACCAGGGCATCGGCATCGTCGTCTTGGCCACCCTGCCCGCAGCTGGTGTCTTCTTCTCCACCTACGAGAGG
GCAAAGACGTTCCTGTCGGGCCGGCTCCCCGGCCCCGAGGCCCTCGTGCACTCGTCCGCGTCGGCTCTGGCCGAG
GTCGCCTCGTGCCTGGTCTTGGCCCCCGCCGAGGTCGTCAAGCAGAATGCGCAGATGCTGCGGCGCGGCACCTCG
TCGTCATCGTCGTCGTCGTCGTCGACGTCGATGCAGGCGTTCCGACAGCTGGCGGGTCCCGGCGCCCGCCGCCGC
CTGTTCACCGGCTATACGGCCTTGGTCGCCAGGAACCTGCCCTTTACCGGCCTGCAGTTCCCCGTCTTTGAGCAT
CTCCGGACCCGGCTGTGGGAGTCGCGGGAGAGGGGGCGTCGCCGCCAGCCCCGTGGTCTTGTTGAGACGGGCCTG
ATCGCCGGGGCCAGCGCCGGGACGGCCGGCGCCGTCGCCGCTTTCCTCACAACGCCCGGCGACGTCGTTAAGACA
CGCATGATGGTGACTGCCGGGGGCGAAGGGAGCGGCGGCGGCGCGACGGGCCCCCGTCCCAAGCAGGGATCGTGG
GCGGTCGCCAAGCAGGTACACCGCGAGCGAGGCATCAGGGGCCTCTTCCGAGGGGGCCTCTTTCGCTCCAGCTGG
ACCGCCTTGGGCAGCTCGCTGTATCTCGGGTCGTACGATACGGCCAAGCTGTGGCTGAGGCGGAGGAAAGATGGG
CGAGAGGACGATTCGATTAGTAGTCTCTAA
Gene >Hirsu2|481
ATGGACGTTTACGTGGTACGCGCGTGCTCCAATGGCCTGTCGAGAGAGAAAGGGGCACGCGGGACCTGGCTGACG
AGGGTGCGCAGGCCGGAGCGGTGGCCGCCTTCACCGTCGACGTGCTCGTCTACCCGCTCGACACGCTCAAGACGC
GCTACCAGAGCCAGGACTACCTCAAGGCCTACCGGTCCGGCTCTGGGGGCAATGCGCTGGCCCTGGCCGGCCTGT
ACCAGGGCATCGGCATCGTCGTCTTGGCCACCCTGCCCGCAGGTGAGAGCGACCATGTTACGAGCAGAGTGAAGA
GAAAAAAAGGGTCGGGACGGCGGAATGCTGACGGCTCTGGCCTCTGTTTTCGCTCGCCCAGCTGGTGTCTTCTTC
TCCACCTACGAGAGGGCAAAGACGTTCCTGTCGGGCCGGCTCCCCGGCCCCGAGGCCCTCGTGCACTCGTCCGCG
TCGGCTCTGGCCGAGGTCGCCTCGTGCCTGGTCTTGGCCCCCGCCGAGGTCGTCAAGCAGAATGCGCAGATGCTG
CGGCGCGGCACCTCGTCGTCATCGTCGTCGTCGTCGTCGACGTCGATGCAGGCGTTCCGACAGCTGGCGGGTCCC
GGCGCCCGCCGCCGCCTGTTCACCGGCTATACGGCCTTGGTCGCCAGGAACCTGCCCTTTACCGGCCTGCAGTTC
CCCGTCTTTGAGCATCTCCGGACCCGGCTGTGGGAGTCGCGGGAGAGGGGGCGTCGCCGCCAGCCCCGTGGTCTT
GTTGAGACGGGCCTGATCGCCGGGGCCAGCGCCGGGACGGCCGGCGCCGTCGCCGCTTTCCTCACAACGCCCGGC
GACGTCGTTAAGACACGCATGATGGTGACTGCCGGGGGCGAAGGGAGCGGCGGCGGCGCGACGGGCCCCCGTCCC
AAGCAGGGATCGTGGGCGGTCGCCAAGCAGGTACACCGCGAGCGAGGCATCAGGGGCCTCTTCCGAGGGGGCCTC
TTTCGCTCCAGCTGGACCGCCTTGGGCAGCTCGCTGTATCTCGGGTCGTACGATACGGCCAAGCTGTGGCTGAGG
CGGAGGAAAGATGGGCGAGAGGACGATTCGATTAGTAGTCTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail