Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4805
Gene name
LocationContig_242:19293..20771
Strand+
Gene length (bp)1478
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 1.8E-09 251 318
PF04851 ResIII Type III restriction enzyme, res subunit 3.7E-07 254 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 2 339 7.0E-44
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 222 336 7.0E-30
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 207 341 1.0E-27
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 199 338 3.0E-25
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 222 334 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 2 339 7.0E-44
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 222 336 7.0E-30
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 207 341 1.0E-27
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 199 338 3.0E-25
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 222 334 1.0E-24
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 185 316 3.0E-07
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 185 316 3.0E-07
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 246 316 4.0E-07
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 185 316 6.0E-07
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 203 317 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4805
MQYSASLTNASGKSITPETIISVSATAALNKLSIESHVKRNTNQPKANTRKQVPKSGRQRALEEAKKVQRRKLED
KSTTATSFWEERLGEFRSEWSLTKRFHKTAKYLDGLSDQDRQVIAAEASIYVCDILASMILEGRRKGDRAAELGL
YAMIWANLRQMGNMQLSPDCFATYKAFLALLKMNVPPEAAADMSMKSRKLPFETVLEVSRAELKLPVELVEFQLQ
NCGPYLERSFDAAPDARVPNFQPDAWQRKVLDAIDADKSLFVVAPTSAGKTFISFYAMKKILQSDNDGTLVYVAP
TKALVNQIAAEIQARFSKSYGNDGRSVWAIHTRDCRVNSSQSLG*
Coding >Hirsu2|4805
ATGCAGTACTCCGCTAGCCTGACCAACGCCTCGGGAAAGAGCATCACCCCAGAGACAATAATCTCAGTTTCCGCA
ACCGCTGCTTTGAATAAGTTGAGCATAGAGAGCCACGTTAAGCGAAATACGAACCAGCCCAAAGCAAACACTAGA
AAGCAGGTCCCCAAGAGCGGTCGACAGAGGGCTTTAGAAGAGGCCAAGAAGGTCCAGAGGAGAAAGCTGGAAGAC
AAGTCCACCACGGCAACGTCCTTTTGGGAAGAGCGTCTGGGCGAGTTTCGGTCGGAATGGAGCCTCACGAAGCGG
TTCCATAAGACGGCCAAATACTTGGACGGCCTATCTGATCAAGACAGACAGGTCATTGCCGCGGAAGCCTCCATT
TACGTCTGTGACATCCTGGCGTCTATGATACTTGAGGGCAGACGAAAGGGGGACAGGGCAGCCGAACTGGGCTTG
TATGCCATGATTTGGGCAAACCTGCGCCAGATGGGGAACATGCAGCTCTCGCCAGACTGTTTTGCCACCTACAAG
GCGTTCCTGGCTCTTCTCAAGATGAACGTGCCACCCGAGGCGGCCGCGGATATGTCCATGAAATCAAGAAAACTA
CCTTTCGAGACTGTCCTGGAAGTCTCAAGGGCCGAGCTCAAACTCCCAGTCGAGCTGGTCGAGTTTCAGCTGCAG
AACTGCGGACCGTATCTCGAGAGAAGTTTTGACGCAGCCCCGGACGCCCGTGTGCCGAACTTCCAGCCAGATGCC
TGGCAGCGAAAAGTCCTGGACGCCATCGATGCCGACAAAAGCCTGTTCGTAGTTGCGCCGACCTCGGCCGGCAAG
ACATTCATCTCGTTTTACGCAATGAAGAAGATTTTGCAGTCGGACAACGATGGCACTCTCGTCTATGTTGCTCCC
ACCAAGGCATTGGTCAACCAGATTGCCGCGGAGATCCAGGCCCGATTCTCCAAGTCATACGGCAATGACGGCAGA
TCTGTCTGGGCCATTCACACGAGAGACTGTAGGGTCAACAGCTCCCAGTCCCTGGGTTAG
Transcript >Hirsu2|4805
ATGCAGTACTCCGCTAGCCTGACCAACGCCTCGGGAAAGAGCATCACCCCAGAGACAATAATCTCAGTTTCCGCA
ACCGCTGCTTTGAATAAGTTGAGCATAGAGAGCCACGTTAAGCGAAATACGAACCAGCCCAAAGCAAACACTAGA
AAGCAGGTCCCCAAGAGCGGTCGACAGAGGGCTTTAGAAGAGGCCAAGAAGGTCCAGAGGAGAAAGCTGGAAGAC
AAGTCCACCACGGCAACGTCCTTTTGGGAAGAGCGTCTGGGCGAGTTTCGGTCGGAATGGAGCCTCACGAAGCGG
TTCCATAAGACGGCCAAATACTTGGACGGCCTATCTGATCAAGACAGACAGGTCATTGCCGCGGAAGCCTCCATT
TACGTCTGTGACATCCTGGCGTCTATGATACTTGAGGGCAGACGAAAGGGGGACAGGGCAGCCGAACTGGGCTTG
TATGCCATGATTTGGGCAAACCTGCGCCAGATGGGGAACATGCAGCTCTCGCCAGACTGTTTTGCCACCTACAAG
GCGTTCCTGGCTCTTCTCAAGATGAACGTGCCACCCGAGGCGGCCGCGGATATGTCCATGAAATCAAGAAAACTA
CCTTTCGAGACTGTCCTGGAAGTCTCAAGGGCCGAGCTCAAACTCCCAGTCGAGCTGGTCGAGTTTCAGCTGCAG
AACTGCGGACCGTATCTCGAGAGAAGTTTTGACGCAGCCCCGGACGCCCGTGTGCCGAACTTCCAGCCAGATGCC
TGGCAGCGAAAAGTCCTGGACGCCATCGATGCCGACAAAAGCCTGTTCGTAGTTGCGCCGACCTCGGCCGGCAAG
ACATTCATCTCGTTTTACGCAATGAAGAAGATTTTGCAGTCGGACAACGATGGCACTCTCGTCTATGTTGCTCCC
ACCAAGGCATTGGTCAACCAGATTGCCGCGGAGATCCAGGCCCGATTCTCCAAGTCATACGGCAATGACGGCAGA
TCTGTCTGGGCCATTCACACGAGAGACTGTAGGGTCAACAGCTCCCAGTCCCTGGGTTAG
Gene >Hirsu2|4805
ATGCAGTACTCCGCTAGCCTGACCAACGCCTCGGGAAAGAGCATCACCCCAGAGACAATAATCTCAGTTTCCGCA
ACCGCTGCTTTGAATAAGTTGAGCATAGAGAGCCACGTTAAGCGAAATACGAACCAGCCCAAAGCAAACACTAGA
AAGCAGGTCCCCAAGAGCGGTCGACAGAGGGCTTTAGAAGAGGCCAAGAAGGTCCAGAGGAGAAAGCTGGAAGAC
AAGTCCACCACGGCAACGTCCTTTTGGGAAGAGCGTCTGGGCGAGTTTCGGTCGGAATGGAGCCTCACGAAGCGG
TTCCATAAGACGGCCAAATACTTGGACGGCCTATCTGATCAAGACAGACAGGTCATTGCCGCGGAAGCCTCCATT
TACGTCTGTGACATCCTGGCGTCTATGATACTTGAGGGCAGACGAAAGGGGGACAGGGCAGCCGGTAAGCAACTA
TGGGTATTGTTTCCCGACCAGTACGGCCCAAGATCTAATCTATGCTGTTTCAGAACTGGGCTTGTATGCCATGAT
TTGGGCAAACCTGCGCCAGATGGGGAACATGCAGCTCTCGCCAGACTGTTTTGCCACCTACAAGGCGTTCCTGGC
TCTTCTCAAGATGAACGTGCCACCCGAGGCGGCCGCGGATATGTCCATGAAATCAAGAAAACTACCTTTCGAGAC
TGTCCTGGAAGTCTCAAGGGCCGAGCTCAAACTCCCAGTCGAGCTGGTCGAGTTTCAGCTGCAGAACTGCGGACC
GTATCTCGAGAGAAGTTTTGACGCAGCCCCGGACGCCCGTGTGCCGAACTTCCAGCCAGATGCCTGGCAGCGAAA
AGTCCTGGACGCCATCGATGCCGACAAAAGCCTGTTCGTAGTTGCGCCGACCTCGGCCGGCAAGACATTCATCTC
GTTTTACGCAATGAAGAAGATTTTGCAGTCGGACAACGATGGCACTCTCGTCTATGTTGCTCCCACCAAGGCATT
GGTCAACCAGATTGCCGCGGAGATCCAGGCCCGATTCTCCAAGTCATACGGCAATGACGGCAGATCTGTCTGGGC
CATTCACACGAGAGACTGTAGGGTCAACAGTCCGTTAGGCTGTCAGGTCCTAGTCACGGTGCCCCATGTCCTCGG
CATCATGCTCCTGGCGCCTTCGAACGCAGAGAGGCCCAATTCCTGGTCTTGCCGAGTCAGAAGAATCATCTTCGA
CGAGGTCCATTGCATCGGACAGTCCAACGACGGCGTCATCTGGGAGCAGCTCCTTCTGCTTGCCCCGTGTCCCAT
CATCGCTCTTTCTGCGACGGTGGGTAATCCAATGGAGTTCAACGCGTGGCTTGAAGAGTCGGAGAGGGCCAAGGG
CAACAAATTAGAAATGATCATGCACTCCTCTCGTTATTCTGACCTGCGGAAATACACTTACAAGCCGCCACGGAT
CTTCGTGTTCAGAGGGCTTGTGCCGACCAACAGGCTCCCAGTCCCTGGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail