Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4800
Gene name
LocationContig_242:1879..5766
Strand-
Gene length (bp)3887
Transcript length (bp)3717
Coding sequence length (bp)3717
Protein length (aa) 1239

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 7.7E-26 79 170
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.4E-04 736 780

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 77 99 22
3 148 170 22
4 522 544 22
5 757 779 22
6 1121 1143 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4800
MDSLARLFLSKGRGCHKARVENLDRDWKPRSMKPPMLGSLAAFSLLLAVTLEVLARRSQALGGLALVPSLDQMPQ
HVVFAYRYMPNIVAVVYSLIWSWVDVDVKRMQPWFELSRRSGARGEDSLFLDYPSQFLPFVPWTSARKRHWPVFF
SSIIMLLVLWIITPLQSTIFDSAMIHQTSWMKIAERSHLAPVERFGQEGLVEEGILHLEYGVKALGQSYPPFTTS
EYALAPYYVDHDPAPPHSDSNWTATTTKMWTELSCSQVQGSRQPGDNSSSIWINDSCQAKVILHYGSVSQCVMLY
RLLNREYFRDRAPGNKDFAAPTELNWTPGCRDMATTEPRILAVWMDLVTQKKPRAGSVTAIVCQTGYYKQKVKAT
TSARGSSLNDSSIHPVSARQRLTESEFDVTWFESLLAKGHGHYDDLRIPTDIRKNPEPLGKESVVAAISESIAGV
VLEPMWALATSGQNLSWEAYSNPVALEAALRRCHQSVFSLAAHRILTKYGDSSHETAESTYLLAGITVSRTFSAI
AESLLVSVAILCIALLWICSRAPCHLRSNPNSISGLIDVFRNSHTVLDAFRRLETDYADEKTLIGLFRHDIFVLL
PRGGKQPYIHTRRVFAVTDRSGTGRQSDRTHEAYYQPIRPFALSRKAGIPFIITISGTIALLSWLKCQELAQHGR
YRMARTVRRLEDGTNCEFVCRAASADRSSSGPPHPRKIHTYDIRDLDRAVLGIDQQAPIIETNYSAFPPQLTVWR
AARSRHFLLAVVGFTTLLGNVLGVGLSALFNERVVAIEHAHQYMPKIAATFQNDPSYFIHGGHHLDFFSAEANFS
YRAPLRAWVSPDYFFFPHEFDRSNAQDRYTLQTRGFGAAMNCTPLTARLQTFNTTKRFQLKKPSCERFLRNAMSE
TLSRIEDEWWEDKRSSGLAALDSYQDFRRLLNYAENDPEPECENIVVVARGRILAAGYNSSTMNISLALCDPAVE
TALFLVTIDALGHVMSYNRISDVVSSSTAPPLDPLAKVTLLTYNRHFYSQLSVDGFVISQGTEPHTWMSFLEASL
TGSRDFLDPEKPTPDPVQMTANIQDVYRRTFAIHLGLRYETVFNKPAPNSTAAQPVLGTRSTQETRIFLDPVAYS
LTISVLSVYVIVAFILYTSGTDCCLPRLPTSIGTILAYVAPSSILTRPAGERETIGFGRYIGADGSARLGIELAP
LVVPIGRPTSKARRFFRRLAPVFGKGEKGADRRSGSWL*
Coding >Hirsu2|4800
ATGGACTCTTTGGCCAGACTTTTCTTATCGAAAGGAAGGGGGTGTCACAAAGCCAGGGTCGAAAACCTGGACCGC
GACTGGAAACCGCGCTCGATGAAGCCCCCGATGCTCGGCTCTCTAGCGGCATTCTCCTTGCTGCTAGCCGTAACT
CTCGAGGTCCTCGCGCGGCGCAGTCAAGCGCTCGGCGGGCTGGCGCTCGTGCCGTCGCTCGATCAAATGCCCCAG
CACGTCGTTTTCGCATATCGCTATATGCCCAACATCGTGGCTGTGGTATACAGCCTAATCTGGAGCTGGGTCGAT
GTCGACGTTAAACGGATGCAGCCCTGGTTTGAGCTCTCGAGACGGAGTGGCGCCAGGGGCGAGGACTCACTATTT
CTCGACTACCCATCCCAGTTTCTGCCCTTCGTGCCGTGGACCTCGGCCAGAAAACGGCACTGGCCCGTATTCTTT
TCGAGTATTATAATGCTTCTTGTCCTATGGATAATCACACCTCTTCAGAGCACTATTTTCGATTCTGCGATGATA
CACCAGACATCTTGGATGAAAATCGCCGAGAGATCGCACCTAGCCCCCGTCGAACGCTTTGGGCAGGAAGGGCTA
GTAGAAGAGGGAATTCTCCATCTCGAGTATGGCGTCAAAGCTCTCGGGCAGTCGTACCCGCCTTTCACCACATCT
GAATACGCCCTCGCCCCTTATTATGTCGACCATGATCCCGCTCCTCCGCACTCAGACTCCAATTGGACCGCCACA
ACGACTAAGATGTGGACAGAGCTGAGCTGTTCACAGGTTCAGGGATCCAGACAGCCAGGTGACAACTCATCTTCT
ATCTGGATCAACGATTCATGTCAGGCCAAGGTGATTTTGCACTACGGATCCGTGAGCCAGTGCGTGATGCTTTAT
CGCCTTCTGAATCGCGAATATTTTAGGGATCGAGCTCCAGGAAACAAGGACTTTGCCGCTCCGACTGAGCTGAAT
TGGACTCCTGGCTGTCGAGACATGGCGACCACCGAGCCTCGGATTCTCGCGGTATGGATGGACCTGGTGACGCAG
AAGAAGCCCCGTGCAGGAAGCGTCACGGCCATAGTCTGCCAAACTGGGTACTATAAGCAAAAGGTCAAGGCTACT
ACCAGTGCCCGAGGATCGAGTTTGAACGACAGTTCCATTCACCCTGTGTCGGCGAGACAAAGGTTGACGGAGTCG
GAATTTGACGTCACGTGGTTCGAGTCGCTACTCGCAAAGGGACATGGACACTACGACGATCTTCGAATTCCGACC
GACATACGGAAGAATCCCGAACCACTAGGCAAGGAATCCGTCGTCGCGGCCATTTCTGAGAGCATAGCAGGAGTG
GTACTCGAGCCCATGTGGGCTCTTGCTACTTCTGGGCAAAACTTATCGTGGGAGGCCTACAGCAATCCAGTAGCG
CTCGAAGCAGCGTTAAGAAGATGCCATCAGTCTGTCTTTTCCCTCGCCGCACATCGAATACTGACTAAATATGGT
GACTCTTCTCACGAAACGGCTGAGTCGACTTACCTGTTGGCCGGAATTACCGTCAGCAGAACGTTTTCCGCTATT
GCGGAATCCCTCTTGGTATCGGTAGCAATTCTTTGCATAGCCCTTCTCTGGATCTGCTCTCGGGCGCCCTGTCAT
CTTCGATCGAATCCAAACTCCATCTCTGGGCTGATAGACGTCTTTCGGAATAGTCACACTGTCCTCGATGCATTC
CGCCGTCTTGAGACCGACTATGCCGATGAGAAGACCTTGATAGGTCTGTTCCGGCATGACATATTTGTCTTGTTG
CCTCGTGGAGGAAAACAGCCGTACATACACACCAGACGAGTTTTCGCGGTAACTGATAGGAGCGGCACTGGACGC
CAGTCGGACAGGACGCACGAGGCTTACTACCAACCAATTCGCCCCTTTGCCCTTAGTCGGAAGGCCGGAATACCA
TTCATCATCACCATTTCGGGTACGATTGCTCTTCTTTCCTGGTTGAAGTGTCAGGAGCTCGCACAGCATGGTAGG
TATAGGATGGCACGAACCGTCCGTCGACTCGAGGATGGTACTAACTGCGAGTTCGTATGCAGGGCTGCCTCGGCC
GACCGATCAAGCTCTGGTCCTCCGCATCCTAGAAAAATACATACCTACGATATTCGCGACCTTGATCGAGCCGTT
TTGGGTATTGATCAACAGGCTCCTATCATTGAAACCAACTACTCGGCTTTCCCACCCCAGCTAACGGTCTGGAGA
GCAGCAAGATCGCGACATTTTCTTCTGGCCGTTGTGGGCTTCACCACACTACTGGGGAATGTCCTAGGAGTTGGG
CTGTCGGCTCTATTCAACGAGAGAGTCGTGGCTATCGAACATGCTCACCAGTATATGCCGAAGATCGCGGCCACA
TTTCAAAACGATCCCTCGTACTTCATACATGGAGGCCACCATCTCGACTTCTTCTCCGCCGAGGCAAACTTCTCA
TACCGAGCCCCGCTGAGAGCCTGGGTCAGCCCGGATTACTTCTTCTTCCCACATGAGTTTGACAGATCCAACGCG
CAGGATAGGTACACGCTTCAGACGCGTGGGTTCGGTGCCGCCATGAATTGCACGCCCCTGACGGCTCGGCTCCAG
ACGTTCAACACGACGAAGCGTTTTCAGCTGAAAAAGCCAAGTTGCGAACGCTTTCTTCGGAACGCCATGAGCGAG
ACACTCTCGCGAATCGAAGATGAGTGGTGGGAGGACAAACGCTCCAGCGGGCTCGCGGCCTTGGACAGCTACCAG
GATTTCAGACGCCTTTTGAACTACGCCGAGAACGACCCTGAACCTGAATGCGAAAATATAGTGGTCGTTGCCCGG
GGTAGGATCCTCGCCGCCGGATACAACAGTTCGACCATGAACATAAGCCTGGCGCTTTGCGACCCGGCAGTCGAA
ACAGCTCTGTTTCTTGTCACGATCGACGCCCTGGGCCATGTCATGTCCTACAATAGGATAAGCGACGTTGTATCA
TCAAGCACCGCGCCCCCCCTCGACCCCTTGGCCAAAGTGACCTTATTGACATATAATAGACATTTCTATTCGCAG
TTGAGTGTGGATGGTTTTGTCATATCCCAGGGGACTGAGCCGCACACCTGGATGAGCTTTCTCGAGGCTTCATTG
ACCGGCTCGCGCGATTTTCTCGATCCGGAAAAACCAACGCCTGATCCAGTCCAGATGACGGCGAATATTCAAGAC
GTATATCGTCGAACCTTTGCGATACACCTCGGCCTCCGTTATGAGACAGTATTCAACAAGCCGGCCCCAAACAGC
ACTGCAGCGCAGCCCGTGCTGGGAACAAGGTCGACGCAGGAAACAAGAATCTTTCTCGATCCGGTCGCCTACTCT
CTCACCATATCCGTGCTGTCGGTCTACGTCATCGTCGCCTTTATTCTCTATACCTCGGGCACCGACTGCTGTCTC
CCGCGCCTGCCGACCAGCATAGGCACCATCCTGGCCTATGTTGCCCCGAGCAGCATTCTGACCAGACCGGCAGGC
GAGCGCGAGACCATCGGCTTCGGGCGGTACATTGGCGCCGATGGATCTGCGCGCCTGGGCATCGAGCTCGCACCG
CTGGTTGTGCCCATCGGCCGACCGACTTCGAAGGCGAGGAGATTCTTCCGCCGTCTCGCTCCGGTTTTTGGGAAG
GGGGAGAAGGGCGCGGACCGGCGCTCCGGCAGCTGGCTGTAA
Transcript >Hirsu2|4800
ATGGACTCTTTGGCCAGACTTTTCTTATCGAAAGGAAGGGGGTGTCACAAAGCCAGGGTCGAAAACCTGGACCGC
GACTGGAAACCGCGCTCGATGAAGCCCCCGATGCTCGGCTCTCTAGCGGCATTCTCCTTGCTGCTAGCCGTAACT
CTCGAGGTCCTCGCGCGGCGCAGTCAAGCGCTCGGCGGGCTGGCGCTCGTGCCGTCGCTCGATCAAATGCCCCAG
CACGTCGTTTTCGCATATCGCTATATGCCCAACATCGTGGCTGTGGTATACAGCCTAATCTGGAGCTGGGTCGAT
GTCGACGTTAAACGGATGCAGCCCTGGTTTGAGCTCTCGAGACGGAGTGGCGCCAGGGGCGAGGACTCACTATTT
CTCGACTACCCATCCCAGTTTCTGCCCTTCGTGCCGTGGACCTCGGCCAGAAAACGGCACTGGCCCGTATTCTTT
TCGAGTATTATAATGCTTCTTGTCCTATGGATAATCACACCTCTTCAGAGCACTATTTTCGATTCTGCGATGATA
CACCAGACATCTTGGATGAAAATCGCCGAGAGATCGCACCTAGCCCCCGTCGAACGCTTTGGGCAGGAAGGGCTA
GTAGAAGAGGGAATTCTCCATCTCGAGTATGGCGTCAAAGCTCTCGGGCAGTCGTACCCGCCTTTCACCACATCT
GAATACGCCCTCGCCCCTTATTATGTCGACCATGATCCCGCTCCTCCGCACTCAGACTCCAATTGGACCGCCACA
ACGACTAAGATGTGGACAGAGCTGAGCTGTTCACAGGTTCAGGGATCCAGACAGCCAGGTGACAACTCATCTTCT
ATCTGGATCAACGATTCATGTCAGGCCAAGGTGATTTTGCACTACGGATCCGTGAGCCAGTGCGTGATGCTTTAT
CGCCTTCTGAATCGCGAATATTTTAGGGATCGAGCTCCAGGAAACAAGGACTTTGCCGCTCCGACTGAGCTGAAT
TGGACTCCTGGCTGTCGAGACATGGCGACCACCGAGCCTCGGATTCTCGCGGTATGGATGGACCTGGTGACGCAG
AAGAAGCCCCGTGCAGGAAGCGTCACGGCCATAGTCTGCCAAACTGGGTACTATAAGCAAAAGGTCAAGGCTACT
ACCAGTGCCCGAGGATCGAGTTTGAACGACAGTTCCATTCACCCTGTGTCGGCGAGACAAAGGTTGACGGAGTCG
GAATTTGACGTCACGTGGTTCGAGTCGCTACTCGCAAAGGGACATGGACACTACGACGATCTTCGAATTCCGACC
GACATACGGAAGAATCCCGAACCACTAGGCAAGGAATCCGTCGTCGCGGCCATTTCTGAGAGCATAGCAGGAGTG
GTACTCGAGCCCATGTGGGCTCTTGCTACTTCTGGGCAAAACTTATCGTGGGAGGCCTACAGCAATCCAGTAGCG
CTCGAAGCAGCGTTAAGAAGATGCCATCAGTCTGTCTTTTCCCTCGCCGCACATCGAATACTGACTAAATATGGT
GACTCTTCTCACGAAACGGCTGAGTCGACTTACCTGTTGGCCGGAATTACCGTCAGCAGAACGTTTTCCGCTATT
GCGGAATCCCTCTTGGTATCGGTAGCAATTCTTTGCATAGCCCTTCTCTGGATCTGCTCTCGGGCGCCCTGTCAT
CTTCGATCGAATCCAAACTCCATCTCTGGGCTGATAGACGTCTTTCGGAATAGTCACACTGTCCTCGATGCATTC
CGCCGTCTTGAGACCGACTATGCCGATGAGAAGACCTTGATAGGTCTGTTCCGGCATGACATATTTGTCTTGTTG
CCTCGTGGAGGAAAACAGCCGTACATACACACCAGACGAGTTTTCGCGGTAACTGATAGGAGCGGCACTGGACGC
CAGTCGGACAGGACGCACGAGGCTTACTACCAACCAATTCGCCCCTTTGCCCTTAGTCGGAAGGCCGGAATACCA
TTCATCATCACCATTTCGGGTACGATTGCTCTTCTTTCCTGGTTGAAGTGTCAGGAGCTCGCACAGCATGGTAGG
TATAGGATGGCACGAACCGTCCGTCGACTCGAGGATGGTACTAACTGCGAGTTCGTATGCAGGGCTGCCTCGGCC
GACCGATCAAGCTCTGGTCCTCCGCATCCTAGAAAAATACATACCTACGATATTCGCGACCTTGATCGAGCCGTT
TTGGGTATTGATCAACAGGCTCCTATCATTGAAACCAACTACTCGGCTTTCCCACCCCAGCTAACGGTCTGGAGA
GCAGCAAGATCGCGACATTTTCTTCTGGCCGTTGTGGGCTTCACCACACTACTGGGGAATGTCCTAGGAGTTGGG
CTGTCGGCTCTATTCAACGAGAGAGTCGTGGCTATCGAACATGCTCACCAGTATATGCCGAAGATCGCGGCCACA
TTTCAAAACGATCCCTCGTACTTCATACATGGAGGCCACCATCTCGACTTCTTCTCCGCCGAGGCAAACTTCTCA
TACCGAGCCCCGCTGAGAGCCTGGGTCAGCCCGGATTACTTCTTCTTCCCACATGAGTTTGACAGATCCAACGCG
CAGGATAGGTACACGCTTCAGACGCGTGGGTTCGGTGCCGCCATGAATTGCACGCCCCTGACGGCTCGGCTCCAG
ACGTTCAACACGACGAAGCGTTTTCAGCTGAAAAAGCCAAGTTGCGAACGCTTTCTTCGGAACGCCATGAGCGAG
ACACTCTCGCGAATCGAAGATGAGTGGTGGGAGGACAAACGCTCCAGCGGGCTCGCGGCCTTGGACAGCTACCAG
GATTTCAGACGCCTTTTGAACTACGCCGAGAACGACCCTGAACCTGAATGCGAAAATATAGTGGTCGTTGCCCGG
GGTAGGATCCTCGCCGCCGGATACAACAGTTCGACCATGAACATAAGCCTGGCGCTTTGCGACCCGGCAGTCGAA
ACAGCTCTGTTTCTTGTCACGATCGACGCCCTGGGCCATGTCATGTCCTACAATAGGATAAGCGACGTTGTATCA
TCAAGCACCGCGCCCCCCCTCGACCCCTTGGCCAAAGTGACCTTATTGACATATAATAGACATTTCTATTCGCAG
TTGAGTGTGGATGGTTTTGTCATATCCCAGGGGACTGAGCCGCACACCTGGATGAGCTTTCTCGAGGCTTCATTG
ACCGGCTCGCGCGATTTTCTCGATCCGGAAAAACCAACGCCTGATCCAGTCCAGATGACGGCGAATATTCAAGAC
GTATATCGTCGAACCTTTGCGATACACCTCGGCCTCCGTTATGAGACAGTATTCAACAAGCCGGCCCCAAACAGC
ACTGCAGCGCAGCCCGTGCTGGGAACAAGGTCGACGCAGGAAACAAGAATCTTTCTCGATCCGGTCGCCTACTCT
CTCACCATATCCGTGCTGTCGGTCTACGTCATCGTCGCCTTTATTCTCTATACCTCGGGCACCGACTGCTGTCTC
CCGCGCCTGCCGACCAGCATAGGCACCATCCTGGCCTATGTTGCCCCGAGCAGCATTCTGACCAGACCGGCAGGC
GAGCGCGAGACCATCGGCTTCGGGCGGTACATTGGCGCCGATGGATCTGCGCGCCTGGGCATCGAGCTCGCACCG
CTGGTTGTGCCCATCGGCCGACCGACTTCGAAGGCGAGGAGATTCTTCCGCCGTCTCGCTCCGGTTTTTGGGAAG
GGGGAGAAGGGCGCGGACCGGCGCTCCGGCAGCTGGCTGTAA
Gene >Hirsu2|4800
ATGGACTCTTTGGCCAGACTTTTCTTATCGAAAGGAAGGGGGTGTCACAAAGCCAGGGTCGAAAGTGAGTTGCTA
GAGTGCAGCTCAGGTTTCTCACTTAGCTCATTCTGTTTTCGTTGCTCCCAGACCTGGACCGCGACTGGAAACCGC
GCTCGATGAAGCCCCCGATGCTCGGCTCTCTAGCGGCATTCTCCTTGCTGCTAGCCGTAACTCTCGAGGTCCTCG
CGCGGCGCAGTCAAGCGCTCGGCGGGCTGGCGCTCGTGCCGTCGCTCGATCAAATGCCCCAGCACGTCGTTTTCG
CATATCGCTATATGCCCAACATCGTGGCTGTGGTATACAGCCTAATCTGGAGCTGGGTCGATGTCGACGTTAAAC
GGATGCAGCCCTGGTTTGAGCTCTCGAGACGGAGTGGCGCCAGGGGCGAGGACTCACTATTTCTCGACTACCCAT
CCCAGTTTCTGCCCTTCGTGCCGTGGACCTCGGCCAGAAAACGGTAAGCAGTTTTTGTCGCTGAGCGTTCAGAGT
TGAGAATAACAGTATCTTTAGGCACTGGCCCGTATTCTTTTCGAGTATTATAATGCTTCTTGTCCTATGGATAAT
CACACCTCTTCAGAGCACTATTTTCGATTCTGCGATGATACACCAGACATCTTGGATGAAAATCGCCGAGAGATC
GCACCTAGCCCCCGTCGAACGCTTTGGGCAGGAAGGGCTAGTAGAAGAGGGAATTCTCCATCTCGAGTATGGCGT
CAAAGCTCTCGGGCAGTCGTACCCGCCTTTCACCACATCTGAATACGCCCTCGCCCCTTATTATGTCGACCATGA
TCCCGCTCCTCCGCACTCAGACTCCAATTGGACCGCCACAACGACTAAGATGTGGACAGAGCTGAGCTGTTCACA
GGTTCAGGGATCCAGACAGCCAGGTGACAACTCATCTTCTATCTGGATCAACGATTCATGTCAGGCCAAGGTGAT
TTTGCACTACGGATCCGTGAGCCAGTGCGTGATGCTTTATCGCCTTCTGAATCGCGAATATTTTAGGGATCGAGC
TCCAGGAAACAAGGACTTTGCCGCTCCGACTGAGCTGAATTGGACTCCTGGCTGTCGAGACATGGCGACCACCGA
GCCTCGGATTCTCGCGGTATGGATGGACCTGGTGACGCAGAAGAAGCCCCGTGCAGGAAGCGTCACGGCCATAGT
CTGCCAAACTGGGTACTATAAGCAAAAGGTCAAGGCTACTACCAGTGCCCGAGGATCGAGTTTGAACGACAGTTC
CATTCACCCTGTGTCGGCGAGACAAAGGTTGACGGAGTCGGAATTTGACGTCACGTGGTTCGAGTCGCTACTCGC
AAAGGGACATGGACACTACGACGATCTTCGAATTCCGACCGACATACGGAAGAATCCCGAACCACTAGGCAAGGA
ATCCGTCGTCGCGGCCATTTCTGAGAGCATAGCAGGAGTGGTACTCGAGCCCATGTGGGCTCTTGCTACTTCTGG
GCAAAACTTATCGTGGGAGGCCTACAGCAATCCAGTAGCGCTCGAAGCAGCGTTAAGAAGATGCCATCAGTCTGT
CTTTTCCCTCGCCGCACATCGAATACTGACTAAATATGGTGACTCTTCTCACGAAACGGCTGAGTCGACTTACCT
GTTGGCCGGAATTACCGTCAGCAGAACGTTTTCCGCTATTGCGGAATCCCTCTTGGTATCGGTAGCAATTCTTTG
CATAGCCCTTCTCTGGATCTGCTCTCGGGCGCCCTGTCATCTTCGATCGAATCCAAACTCCATCTCTGGGCTGAT
AGACGTCTTTCGGAATAGTCACACTGTCCTCGATGCATTCCGCCGTCTTGAGACCGACTATGCCGATGAGAAGAC
CTTGATAGGTCTGTTCCGGCATGACATATTTGTCTTGTTGCCTCGTGGAGGAAAACAGCCGTACATACACACCAG
ACGAGTTTTCGCGGTAACTGATAGGAGCGGCACTGGACGCCAGTCGGACAGGACGCACGAGGCTTACTACCAACC
AATTCGCCCCTTTGCCCTTAGTCGGAAGGCCGGAATACCATTCATCATCACCATTTCGGGTACGATTGCTCTTCT
TTCCTGGTTGAAGTGTCAGGAGCTCGCACAGCATGGTAGGTATAGGATGGCACGAACCGTCCGTCGACTCGAGGA
TGGTACTAACTGCGAGTTCGTATGCAGGGCTGCCTCGGCCGACCGATCAAGCTCTGGTCCTCCGCATCCTAGAAA
AATACATACCTACGATATTCGCGACCTTGATCGAGCCGTTTTGGGTATTGATCAACAGGCTCCTATGTACGATGA
AACCTTTCGACGAGCTCCGGAGAGGAAAGGCGCTACCGGCCAGAAGCATTGAAACCAACTACTCGGCTTTCCCAC
CCCAGCTAACGGTCTGGAGAGCAGCAAGATCGCGACATTTTCTTCTGGCCGTTGTGGGCTTCACCACACTACTGG
GGAATGTCCTAGGAGTTGGGCTGTCGGCTCTATTCAACGAGAGAGTCGTGGCTATCGAACATGCTCACCAGTATA
TGCCGAAGATCGCGGCCACATTTCAAAACGATCCCTCGTACTTCATACATGGAGGCCACCATCTCGACTTCTTCT
CCGCCGAGGCAAACTTCTCATACCGAGCCCCGCTGAGAGCCTGGGTCAGCCCGGATTACTTCTTCTTCCCACATG
AGTTTGACAGATCCAACGCGCAGGATAGGTACACGCTTCAGACGCGTGGGTTCGGTGCCGCCATGAATTGCACGC
CCCTGACGGCTCGGCTCCAGACGTTCAACACGACGAAGCGTTTTCAGCTGAAAAAGCCAAGTTGCGAACGCTTTC
TTCGGAACGCCATGAGCGAGACACTCTCGCGAATCGAAGATGAGTGGTGGGAGGACAAACGCTCCAGCGGGCTCG
CGGCCTTGGACAGCTACCAGGATTTCAGACGCCTTTTGAACTACGCCGAGAACGACCCTGAACCTGAATGCGAAA
ATATAGTGGTCGTTGCCCGGGGTAGGATCCTCGCCGCCGGATACAACAGTTCGACCATGAACATAAGCCTGGCGC
TTTGCGACCCGGCAGTCGAAACAGCTCTGTTTCTTGTCACGATCGACGCCCTGGGCCATGTCATGTCCTACAATA
GGATAAGCGACGTTGTATCATCAAGCACCGCGCCCCCCCTCGACCCCTTGGCCAAAGTGACCTTATTGACATATA
ATAGACATTTCTATTCGCAGTTGAGTGTGGATGGTTTTGTCATATCCCAGGGGACTGAGCCGCACACCTGGATGA
GCTTTCTCGAGGCTTCATTGACCGGCTCGCGCGATTTTCTCGATCCGGAAAAACCAACGCCTGATCCAGTCCAGA
TGACGGCGAATATTCAAGACGTATATCGTCGAACCTTTGCGATACACCTCGGCCTCCGTTATGAGACAGTATTCA
ACAAGCCGGCCCCAAACAGCACTGCAGCGCAGCCCGTGCTGGGAACAAGGTCGACGCAGGAAACAAGAATCTTTC
TCGATCCGGTCGCCTACTCTCTCACCATATCCGTGCTGTCGGTCTACGTCATCGTCGCCTTTATTCTCTATACCT
CGGGCACCGACTGCTGTCTCCCGCGCCTGCCGACCAGCATAGGCACCATCCTGGCCTATGTTGCCCCGAGCAGCA
TTCTGACCAGACCGGCAGGCGAGCGCGAGACCATCGGCTTCGGGCGGTACATTGGCGCCGATGGATCTGCGCGCC
TGGGCATCGAGCTCGCACCGCTGGTTGTGCCCATCGGCCGACCGACTTCGAAGGCGAGGAGATTCTTCCGCCGTC
TCGCTCCGGTTTTTGGGAAGGGGGAGAAGGGCGCGGACCGGCGCTCCGGCAGCTGGCTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail