Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|48
Gene name
LocationContig_1002:7274..10004
Strand+
Gene length (bp)2730
Transcript length (bp)2676
Coding sequence length (bp)2676
Protein length (aa) 892

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 3.1E-81 515 819
PF16486 ArgoN N-terminal domain of argonaute 8.0E-15 7 131
PF08699 ArgoL1 Argonaute linker 1 domain 1.9E-12 142 198
PF16488 ArgoL2 Argonaute linker 2 domain 9.2E-12 369 412
PF02170 PAZ PAZ domain 3.4E-10 244 358
PF16487 ArgoMid Mid domain of argonaute 9.8E-07 424 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 29 820 3.0E-117
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 8 854 3.0E-98
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 8 825 5.0E-96
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 7 817 1.0E-95
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 8 835 3.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 29 820 3.0E-117
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 8 854 3.0E-98
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 8 825 5.0E-96
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 7 817 1.0E-95
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 8 835 3.0E-95
sp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C OS=Oryza sativa subsp. japonica GN=AGO1C PE=2 SV=1 7 817 5.0E-94
sp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D OS=Oryza sativa subsp. japonica GN=AGO1D PE=2 SV=1 8 817 9.0E-93
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 8 817 2.0E-92
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 10 840 6.0E-90
sp|Q69VD5|PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica GN=PHN1 PE=2 SV=1 8 844 4.0E-88
sp|Q7Y001|AGO12_ORYSJ Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2 8 832 1.0E-83
sp|Q6Z4F1|AGO14_ORYSJ Protein argonaute 14 OS=Oryza sativa subsp. japonica GN=AGO14 PE=2 SV=1 10 834 1.0E-80
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 13 817 6.0E-79
sp|O77503|AGO2_RABIT Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus GN=AGO2 PE=1 SV=2 50 819 3.0E-78
sp|Q9UKV8|AGO2_HUMAN Protein argonaute-2 OS=Homo sapiens GN=AGO2 PE=1 SV=3 10 819 6.0E-78
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 10 819 6.0E-78
sp|Q9QZ81|AGO2_RAT Protein argonaute-2 OS=Rattus norvegicus GN=Ago2 PE=2 SV=2 10 819 7.0E-78
sp|A3KPK0|AGO3_DANRE Protein argonaute-3 OS=Danio rerio GN=ago3 PE=3 SV=1 50 819 1.0E-77
sp|Q6DCX2|AGO2_XENLA Protein argonaute-2 OS=Xenopus laevis GN=ago2 PE=2 SV=1 9 819 3.0E-77
sp|Q75HC2|AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2 4 817 7.0E-77
sp|Q5ZLG4|AGO3_CHICK Protein argonaute-3 OS=Gallus gallus GN=AGO3 PE=2 SV=1 50 819 1.0E-76
sp|Q6QME8|AGO2_BOVIN Protein argonaute-2 OS=Bos taurus GN=AGO2 PE=2 SV=1 10 819 4.0E-76
sp|Q8CJG1|AGO1_MOUSE Protein argonaute-1 OS=Mus musculus GN=Ago1 PE=1 SV=2 50 819 6.0E-76
sp|Q9UL18|AGO1_HUMAN Protein argonaute-1 OS=Homo sapiens GN=AGO1 PE=1 SV=3 50 819 6.0E-76
sp|Q8CJF9|AGO3_MOUSE Protein argonaute-3 OS=Mus musculus GN=Ago3 PE=2 SV=2 50 819 2.0E-75
sp|Q9H9G7|AGO3_HUMAN Protein argonaute-3 OS=Homo sapiens GN=AGO3 PE=1 SV=2 50 819 3.0E-75
sp|Q6DJB9|AGO2_XENTR Protein argonaute-2 OS=Xenopus tropicalis GN=ago2 PE=2 SV=1 50 819 6.0E-75
sp|Q10F39|AGO11_ORYSJ Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2 271 817 2.0E-74
sp|Q0JF58|AGO4B_ORYSJ Protein argonaute 4B OS=Oryza sativa subsp. japonica GN=AGO4B PE=2 SV=1 49 813 5.0E-74
sp|Q84VQ0|AGO9_ARATH Protein argonaute 9 OS=Arabidopsis thaliana GN=AGO9 PE=1 SV=2 49 813 6.0E-74
sp|Q9ZVD5|AGO4_ARATH Protein argonaute 4 OS=Arabidopsis thaliana GN=AGO4 PE=1 SV=2 49 813 1.0E-73
sp|Q4KLV6|AGO4_XENLA Protein argonaute-4 OS=Xenopus laevis GN=ago4 PE=2 SV=1 10 819 1.0E-72
sp|Q5ZMW0|AGO4_CHICK Protein argonaute-4 OS=Gallus gallus GN=AGO4 PE=2 SV=1 51 819 1.0E-72
sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus GN=AGO3 PE=2 SV=2 50 819 2.0E-72
sp|Q9SHF3|AGO2_ARATH Protein argonaute 2 OS=Arabidopsis thaliana GN=AGO2 PE=1 SV=1 3 829 5.0E-72
sp|Q9C793|AGO7_ARATH Protein argonaute 7 OS=Arabidopsis thaliana GN=AGO7 PE=2 SV=1 4 817 9.0E-72
sp|Q9HCK5|AGO4_HUMAN Protein argonaute-4 OS=Homo sapiens GN=AGO4 PE=1 SV=2 10 819 1.0E-71
sp|Q8CJF8|AGO4_MOUSE Protein argonaute-4 OS=Mus musculus GN=Ago4 PE=2 SV=2 10 819 1.0E-70
sp|Q9SDG8|AGO4A_ORYSJ Protein argonaute 4A OS=Oryza sativa subsp. japonica GN=AGO4A PE=2 SV=1 49 813 4.0E-69
sp|Q852N2|AGO13_ORYSJ Protein argonaute 13 OS=Oryza sativa subsp. japonica GN=AGO13 PE=2 SV=1 11 840 2.0E-68
sp|Q6YSJ5|AGO16_ORYSJ Protein argonaute 16 OS=Oryza sativa subsp. japonica GN=AGO16 PE=2 SV=2 11 813 7.0E-68
sp|P34681|TAG76_CAEEL Putative protein tag-76 OS=Caenorhabditis elegans GN=tag-76 PE=3 SV=2 254 819 1.0E-67
sp|Q7XTS4|AGO2_ORYSJ Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2 282 826 1.0E-66
sp|Q9SHF2|AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana GN=AGO3 PE=3 SV=1 3 817 3.0E-64
sp|Q5NBN9|AGO15_ORYSJ Protein argonaute 15 OS=Oryza sativa subsp. japonica GN=AGO15 PE=2 SV=2 301 813 4.0E-64
sp|Q3E984|AGO8_ARATH Protein argonaute 8 OS=Arabidopsis thaliana GN=AGO8 PE=3 SV=1 49 813 1.0E-61
sp|O48771|AGO6_ARATH Protein argonaute 6 OS=Arabidopsis thaliana GN=AGO6 PE=2 SV=2 51 813 2.0E-61
sp|Q7XTS3|AGO3_ORYSJ Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2 242 817 2.0E-61
sp|Q9VUQ5|AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster GN=AGO2 PE=1 SV=3 11 817 2.0E-54
sp|Q6H6C3|AGO17_ORYSJ Protein argonaute 17 OS=Oryza sativa subsp. japonica GN=AGO17 PE=2 SV=1 317 819 2.0E-53
sp|O61931|ERGO1_CAEEL Piwi-like protein ergo-1 OS=Caenorhabditis elegans GN=ergo-1 PE=1 SV=2 527 817 9.0E-29
sp|Q7PLK0|AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3 271 810 2.0E-28
sp|Q09249|YQ53_CAEEL Uncharacterized protein C16C10.3 OS=Caenorhabditis elegans GN=C16C10.3 PE=3 SV=1 297 823 3.0E-28
sp|Q9JMB7|PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1 271 810 4.0E-28
sp|Q96J94|PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1 271 810 8.0E-28
sp|Q4G033|PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus GN=Piwil4 PE=2 SV=2 299 810 3.0E-26
sp|Q8CGT6|PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus GN=Piwil4 PE=1 SV=3 299 810 3.0E-25
sp|A6N7Y9|PIWL1_CHICK Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 271 825 3.0E-25
sp|Q7Z3Z3|PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens GN=PIWIL3 PE=2 SV=2 299 810 2.0E-24
sp|Q9VKM1|PIWI_DROME Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1 254 793 4.0E-24
sp|Q7Z3Z4|PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens GN=PIWIL4 PE=2 SV=2 299 810 1.0E-23
sp|O76922|AUB_DROME Protein aubergine OS=Drosophila melanogaster GN=aub PE=1 SV=1 296 810 1.0E-23
sp|Q8UVX0|PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1 271 810 3.0E-23
sp|A2CEI6|PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio GN=piwil2 PE=1 SV=2 299 826 1.0E-19
sp|Q21770|WAGO1_CAEEL Argonaute protein wago-1 OS=Caenorhabditis elegans GN=wago-1 PE=1 SV=1 299 827 1.0E-19
sp|Q2Q5Y8|PIWI2_SCHMD Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 532 810 1.0E-18
sp|A8KBF3|PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis GN=piwil2 PE=1 SV=1 388 810 3.0E-18
sp|Q8TC59|PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens GN=PIWIL2 PE=1 SV=1 388 810 7.0E-18
sp|Q2PC95|PIWIL_DUGJA Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1 532 810 2.0E-17
sp|A6P7L8|PIWL2_ONCMY Piwi-like protein 2 OS=Oncorhynchus mykiss GN=piwil2 PE=2 SV=1 388 810 2.0E-16
sp|Q8CDG1|PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus GN=Piwil2 PE=1 SV=2 388 810 3.0E-16
sp|Q21691|NRDE3_CAEEL Nuclear RNAi defective-3 protein OS=Caenorhabditis elegans GN=nrde-3 PE=1 SV=1 289 848 1.0E-14
sp|Q2Q5Y9|PIWI1_SCHMD Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 592 810 2.0E-14
sp|Q86QW7|AGO_GIAIN Protein argonaute OS=Giardia intestinalis GN=Ago PE=1 SV=2 538 825 7.0E-07
sp|A8BCK6|AGO_GIAIC Protein argonaute OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=Ago PE=3 SV=1 538 825 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|48
MKSFDFSKKIFQYDVSISPDVEKKAVVLQKIWVHPGTKQALSRYNYPMWIFDGRKLAWAAAVLDRGEIRFTVDLD
DGKKPPSGQARERSNKFLIAIRQTTAVHMSALQGYLDQKMSYNTEVQVAMNFIDHLIRQYPAQNLLSIKRNFYDV
SQRGVRLTPFGCVEAHKGLYASARLSHNLAKGGIGLALNVDVANTCFWMGNLTVADIMLMFLASCEPKRWGGTTI
NNLAKHLQPVAHKSGGWASSDAFKQLRKMRRLKFKVNHPNRANKEKVYTIIDFAFDQKYGAEGGHARCVTFDYNG
KETTVADYYRQKYKAHLQYGYLPLISAGKGGWIPMEFAILEPMQRYPFKLNPEQTAAMIKFAVTRPQVRRQDIER
NVRNLKLDQDPYLREYGVRFEPEFTKTEARILPAPKVDFSQGQADPKYSGRWDLRGKKFWKQNVAPLQNWAFVVM
DGCVDFPQLQNFAKMFRQTFLGHGGKCPADALLLNMPADSRHDAAKAISFGHEEVSRQRGYTQLLFIVVGHKNSP
HYERLKKSADCRFGILSQVVNGEQVKKSSGQYHSNVCMKVNAKLGGATSRTMAPWKSQPTYFPKDRPTMIVGVDI
SHGAPGGDTPSTAAMTMSVDRDATRYAAMVETNGYRMELLSSANVHFLFGQLVEQWKRGHEGAFPRHIIYFRDGL
SEGQFAQMIEQEVGEMKLFLRSKAPKMPPPKFTVVVATKRHHVRFFPHPKQGDRNGNALPGTLVEKEVTHPFMLD
FYLCSHVAIQGTARPVHYHVLLDEMNVPINEFQKMIYHQCYSYARSTTPVSLHPAVYYAHLAGNRARSHENVYTS
QGFRSGAKGHEVIRDKVAKGISMGSIARGTEAPQLLVLGGQPEPEKGPVDGEMRQRDFFRSTMWYI*
Coding >Hirsu2|48
ATGAAGAGCTTTGACTTCTCCAAAAAAATCTTCCAATATGACGTGAGCATCTCTCCCGACGTGGAGAAGAAGGCC
GTCGTTTTGCAGAAGATTTGGGTCCACCCCGGGACCAAGCAGGCCCTGAGCCGCTACAACTATCCCATGTGGATC
TTCGACGGCCGAAAGCTGGCCTGGGCCGCGGCGGTGCTGGACCGTGGCGAAATCCGCTTCACGGTCGACTTGGAC
GACGGCAAGAAGCCGCCCAGCGGCCAGGCGCGGGAAAGGTCAAACAAATTCCTCATCGCCATTCGCCAGACAACG
GCCGTGCATATGTCGGCGCTTCAAGGCTACCTGGACCAAAAGATGTCCTACAACACGGAGGTTCAGGTGGCTATG
AATTTCATCGACCACCTAATTCGCCAGTACCCGGCACAGAACCTGCTATCCATCAAGCGCAACTTCTACGACGTT
TCGCAGCGAGGTGTCCGCTTGACACCCTTTGGTTGTGTCGAGGCACACAAAGGCCTATACGCCTCGGCCCGACTC
AGCCATAATCTCGCCAAAGGCGGCATCGGCCTGGCCTTGAACGTGGACGTCGCCAACACTTGCTTTTGGATGGGC
AACCTCACGGTGGCCGATATCATGCTCATGTTTCTCGCCTCCTGTGAGCCGAAGCGATGGGGCGGCACAACCATC
AACAACCTTGCCAAGCATCTGCAACCTGTCGCCCACAAATCCGGCGGATGGGCATCGTCGGATGCCTTTAAGCAG
CTCCGCAAAATGCGCCGTCTCAAGTTCAAGGTCAACCACCCGAACCGGGCGAATAAGGAAAAAGTGTACACCATC
ATAGACTTTGCCTTCGATCAGAAGTACGGTGCCGAGGGTGGACACGCCAGATGTGTCACTTTCGATTATAACGGC
AAGGAAACGACTGTGGCCGACTACTACCGACAAAAGTACAAGGCCCATCTCCAGTACGGGTATCTGCCTTTGATC
AGCGCCGGCAAGGGCGGCTGGATCCCGATGGAGTTTGCGATACTGGAGCCCATGCAGCGCTATCCGTTCAAGCTC
AACCCGGAGCAGACGGCGGCCATGATCAAGTTCGCCGTCACCCGTCCTCAGGTGCGACGCCAGGACATTGAAAGG
AATGTCCGCAATTTGAAACTTGACCAGGACCCGTACCTGCGAGAGTACGGAGTACGCTTTGAGCCCGAGTTCACC
AAGACGGAGGCTCGCATTCTGCCTGCGCCCAAGGTGGACTTCAGCCAGGGCCAGGCAGACCCCAAGTACTCTGGC
CGCTGGGATCTGCGCGGGAAGAAGTTCTGGAAGCAGAACGTGGCCCCCCTGCAGAACTGGGCCTTCGTGGTCATG
GACGGCTGCGTCGACTTTCCGCAGCTGCAGAACTTCGCCAAGATGTTCCGCCAGACGTTCCTGGGACATGGCGGT
AAGTGCCCTGCGGACGCATTGCTCCTCAACATGCCGGCGGACTCGAGGCACGACGCCGCCAAGGCCATTTCCTTC
GGGCACGAGGAGGTGTCGAGGCAGCGCGGGTACACGCAGCTCCTCTTCATCGTGGTGGGACACAAGAATAGCCCG
CACTACGAGCGGCTGAAGAAGTCGGCCGATTGCCGCTTTGGAATCCTTTCCCAGGTGGTCAACGGCGAACAGGTG
AAGAAGAGCAGCGGCCAGTACCACTCGAACGTCTGCATGAAGGTCAATGCGAAGCTGGGCGGAGCGACTTCCCGG
ACCATGGCTCCTTGGAAGAGCCAGCCCACGTATTTCCCCAAGGATCGGCCGACGATGATCGTTGGCGTCGACATC
TCGCACGGCGCCCCGGGCGGCGACACTCCGTCGACGGCGGCCATGACCATGTCGGTCGACCGGGACGCCACTCGG
TACGCGGCCATGGTGGAGACGAATGGATACCGCATGGAGCTCCTCAGCTCCGCCAACGTACACTTCCTGTTCGGC
CAGCTGGTGGAGCAGTGGAAGCGTGGCCACGAAGGCGCCTTCCCGCGCCACATCATCTACTTCCGGGACGGCCTG
TCGGAGGGGCAGTTTGCCCAGATGATTGAGCAGGAAGTGGGCGAGATGAAGCTCTTCCTCCGTTCCAAGGCGCCG
AAAATGCCTCCGCCCAAATTCACGGTTGTGGTGGCGACGAAGCGACACCACGTTCGTTTCTTCCCCCACCCGAAA
CAGGGGGACCGTAACGGCAATGCTCTTCCCGGCACTCTGGTGGAGAAAGAAGTCACGCATCCGTTCATGCTCGAC
TTTTATCTATGCAGCCACGTTGCGATCCAAGGAACGGCCCGCCCGGTTCACTACCATGTTCTTTTGGACGAGATG
AACGTTCCGATCAACGAGTTCCAGAAGATGATTTACCACCAGTGCTACTCGTACGCGAGATCAACCACGCCTGTC
TCGCTGCACCCGGCCGTCTACTACGCCCATCTTGCGGGCAACCGAGCCAGATCGCACGAGAACGTGTACACGAGC
CAGGGCTTCCGATCCGGTGCCAAGGGGCACGAGGTGATTCGCGACAAGGTGGCCAAGGGCATCTCGATGGGGAGC
ATTGCTCGCGGCACGGAGGCGCCGCAGCTGCTTGTGCTGGGCGGCCAGCCCGAGCCGGAGAAGGGCCCGGTCGAC
GGAGAGATGCGACAACGCGACTTTTTCCGCAGCACCATGTGGTACATTTAG
Transcript >Hirsu2|48
ATGAAGAGCTTTGACTTCTCCAAAAAAATCTTCCAATATGACGTGAGCATCTCTCCCGACGTGGAGAAGAAGGCC
GTCGTTTTGCAGAAGATTTGGGTCCACCCCGGGACCAAGCAGGCCCTGAGCCGCTACAACTATCCCATGTGGATC
TTCGACGGCCGAAAGCTGGCCTGGGCCGCGGCGGTGCTGGACCGTGGCGAAATCCGCTTCACGGTCGACTTGGAC
GACGGCAAGAAGCCGCCCAGCGGCCAGGCGCGGGAAAGGTCAAACAAATTCCTCATCGCCATTCGCCAGACAACG
GCCGTGCATATGTCGGCGCTTCAAGGCTACCTGGACCAAAAGATGTCCTACAACACGGAGGTTCAGGTGGCTATG
AATTTCATCGACCACCTAATTCGCCAGTACCCGGCACAGAACCTGCTATCCATCAAGCGCAACTTCTACGACGTT
TCGCAGCGAGGTGTCCGCTTGACACCCTTTGGTTGTGTCGAGGCACACAAAGGCCTATACGCCTCGGCCCGACTC
AGCCATAATCTCGCCAAAGGCGGCATCGGCCTGGCCTTGAACGTGGACGTCGCCAACACTTGCTTTTGGATGGGC
AACCTCACGGTGGCCGATATCATGCTCATGTTTCTCGCCTCCTGTGAGCCGAAGCGATGGGGCGGCACAACCATC
AACAACCTTGCCAAGCATCTGCAACCTGTCGCCCACAAATCCGGCGGATGGGCATCGTCGGATGCCTTTAAGCAG
CTCCGCAAAATGCGCCGTCTCAAGTTCAAGGTCAACCACCCGAACCGGGCGAATAAGGAAAAAGTGTACACCATC
ATAGACTTTGCCTTCGATCAGAAGTACGGTGCCGAGGGTGGACACGCCAGATGTGTCACTTTCGATTATAACGGC
AAGGAAACGACTGTGGCCGACTACTACCGACAAAAGTACAAGGCCCATCTCCAGTACGGGTATCTGCCTTTGATC
AGCGCCGGCAAGGGCGGCTGGATCCCGATGGAGTTTGCGATACTGGAGCCCATGCAGCGCTATCCGTTCAAGCTC
AACCCGGAGCAGACGGCGGCCATGATCAAGTTCGCCGTCACCCGTCCTCAGGTGCGACGCCAGGACATTGAAAGG
AATGTCCGCAATTTGAAACTTGACCAGGACCCGTACCTGCGAGAGTACGGAGTACGCTTTGAGCCCGAGTTCACC
AAGACGGAGGCTCGCATTCTGCCTGCGCCCAAGGTGGACTTCAGCCAGGGCCAGGCAGACCCCAAGTACTCTGGC
CGCTGGGATCTGCGCGGGAAGAAGTTCTGGAAGCAGAACGTGGCCCCCCTGCAGAACTGGGCCTTCGTGGTCATG
GACGGCTGCGTCGACTTTCCGCAGCTGCAGAACTTCGCCAAGATGTTCCGCCAGACGTTCCTGGGACATGGCGGT
AAGTGCCCTGCGGACGCATTGCTCCTCAACATGCCGGCGGACTCGAGGCACGACGCCGCCAAGGCCATTTCCTTC
GGGCACGAGGAGGTGTCGAGGCAGCGCGGGTACACGCAGCTCCTCTTCATCGTGGTGGGACACAAGAATAGCCCG
CACTACGAGCGGCTGAAGAAGTCGGCCGATTGCCGCTTTGGAATCCTTTCCCAGGTGGTCAACGGCGAACAGGTG
AAGAAGAGCAGCGGCCAGTACCACTCGAACGTCTGCATGAAGGTCAATGCGAAGCTGGGCGGAGCGACTTCCCGG
ACCATGGCTCCTTGGAAGAGCCAGCCCACGTATTTCCCCAAGGATCGGCCGACGATGATCGTTGGCGTCGACATC
TCGCACGGCGCCCCGGGCGGCGACACTCCGTCGACGGCGGCCATGACCATGTCGGTCGACCGGGACGCCACTCGG
TACGCGGCCATGGTGGAGACGAATGGATACCGCATGGAGCTCCTCAGCTCCGCCAACGTACACTTCCTGTTCGGC
CAGCTGGTGGAGCAGTGGAAGCGTGGCCACGAAGGCGCCTTCCCGCGCCACATCATCTACTTCCGGGACGGCCTG
TCGGAGGGGCAGTTTGCCCAGATGATTGAGCAGGAAGTGGGCGAGATGAAGCTCTTCCTCCGTTCCAAGGCGCCG
AAAATGCCTCCGCCCAAATTCACGGTTGTGGTGGCGACGAAGCGACACCACGTTCGTTTCTTCCCCCACCCGAAA
CAGGGGGACCGTAACGGCAATGCTCTTCCCGGCACTCTGGTGGAGAAAGAAGTCACGCATCCGTTCATGCTCGAC
TTTTATCTATGCAGCCACGTTGCGATCCAAGGAACGGCCCGCCCGGTTCACTACCATGTTCTTTTGGACGAGATG
AACGTTCCGATCAACGAGTTCCAGAAGATGATTTACCACCAGTGCTACTCGTACGCGAGATCAACCACGCCTGTC
TCGCTGCACCCGGCCGTCTACTACGCCCATCTTGCGGGCAACCGAGCCAGATCGCACGAGAACGTGTACACGAGC
CAGGGCTTCCGATCCGGTGCCAAGGGGCACGAGGTGATTCGCGACAAGGTGGCCAAGGGCATCTCGATGGGGAGC
ATTGCTCGCGGCACGGAGGCGCCGCAGCTGCTTGTGCTGGGCGGCCAGCCCGAGCCGGAGAAGGGCCCGGTCGAC
GGAGAGATGCGACAACGCGACTTTTTCCGCAGCACCATGTGGTACATTTAG
Gene >Hirsu2|48
ATGAAGAGCTTTGACTTCTCCAAAAAAATCTTCCAATATGACGTGAGTATCCCTTTCCTGCATTTCTCATCGACT
TTTCCGCTAACGATCCCGTAGGTGAGCATCTCTCCCGACGTGGAGAAGAAGGCCGTCGTTTTGCAGAAGATTTGG
GTCCACCCCGGGACCAAGCAGGCCCTGAGCCGCTACAACTATCCCATGTGGATCTTCGACGGCCGAAAGCTGGCC
TGGGCCGCGGCGGTGCTGGACCGTGGCGAAATCCGCTTCACGGTCGACTTGGACGACGGCAAGAAGCCGCCCAGC
GGCCAGGCGCGGGAAAGGTCAAACAAATTCCTCATCGCCATTCGCCAGACAACGGCCGTGCATATGTCGGCGCTT
CAAGGCTACCTGGACCAAAAGATGTCCTACAACACGGAGGTTCAGGTGGCTATGAATTTCATCGACCACCTAATT
CGCCAGTACCCGGCACAGAACCTGCTATCCATCAAGCGCAACTTCTACGACGTTTCGCAGCGAGGTGTCCGCTTG
ACACCCTTTGGTTGTGTCGAGGCACACAAAGGCCTATACGCCTCGGCCCGACTCAGCCATAATCTCGCCAAAGGC
GGCATCGGCCTGGCCTTGAACGTGGACGTCGCCAACACTTGCTTTTGGATGGGCAACCTCACGGTGGCCGATATC
ATGCTCATGTTTCTCGCCTCCTGTGAGCCGAAGCGATGGGGCGGCACAACCATCAACAACCTTGCCAAGCATCTG
CAACCTGTCGCCCACAAATCCGGCGGATGGGCATCGTCGGATGCCTTTAAGCAGCTCCGCAAAATGCGCCGTCTC
AAGTTCAAGGTCAACCACCCGAACCGGGCGAATAAGGAAAAAGTGTACACCATCATAGACTTTGCCTTCGATCAG
AAGTACGGTGCCGAGGGTGGACACGCCAGATGTGTCACTTTCGATTATAACGGCAAGGAAACGACTGTGGCCGAC
TACTACCGACAAAAGTACAAGGCCCATCTCCAGTACGGGTATCTGCCTTTGATCAGCGCCGGCAAGGGCGGCTGG
ATCCCGATGGAGTTTGCGATACTGGAGCCCATGCAGCGCTATCCGTTCAAGCTCAACCCGGAGCAGACGGCGGCC
ATGATCAAGTTCGCCGTCACCCGTCCTCAGGTGCGACGCCAGGACATTGAAAGGAATGTCCGCAATTTGAAACTT
GACCAGGACCCGTACCTGCGAGAGTACGGAGTACGCTTTGAGCCCGAGTTCACCAAGACGGAGGCTCGCATTCTG
CCTGCGCCCAAGGTGGACTTCAGCCAGGGCCAGGCAGACCCCAAGTACTCTGGCCGCTGGGATCTGCGCGGGAAG
AAGTTCTGGAAGCAGAACGTGGCCCCCCTGCAGAACTGGGCCTTCGTGGTCATGGACGGCTGCGTCGACTTTCCG
CAGCTGCAGAACTTCGCCAAGATGTTCCGCCAGACGTTCCTGGGACATGGCGGTAAGTGCCCTGCGGACGCATTG
CTCCTCAACATGCCGGCGGACTCGAGGCACGACGCCGCCAAGGCCATTTCCTTCGGGCACGAGGAGGTGTCGAGG
CAGCGCGGGTACACGCAGCTCCTCTTCATCGTGGTGGGACACAAGAATAGCCCGCACTACGAGCGGCTGAAGAAG
TCGGCCGATTGCCGCTTTGGAATCCTTTCCCAGGTGGTCAACGGCGAACAGGTGAAGAAGAGCAGCGGCCAGTAC
CACTCGAACGTCTGCATGAAGGTCAATGCGAAGCTGGGCGGAGCGACTTCCCGGACCATGGCTCCTTGGAAGAGC
CAGCCCACGTATTTCCCCAAGGATCGGCCGACGATGATCGTTGGCGTCGACATCTCGCACGGCGCCCCGGGCGGC
GACACTCCGTCGACGGCGGCCATGACCATGTCGGTCGACCGGGACGCCACTCGGTACGCGGCCATGGTGGAGACG
AATGGATACCGCATGGAGCTCCTCAGCTCCGCCAACGTACACTTCCTGTTCGGCCAGCTGGTGGAGCAGTGGAAG
CGTGGCCACGAAGGCGCCTTCCCGCGCCACATCATCTACTTCCGGGACGGCCTGTCGGAGGGGCAGTTTGCCCAG
ATGATTGAGCAGGAAGTGGGCGAGATGAAGCTCTTCCTCCGTTCCAAGGCGCCGAAAATGCCTCCGCCCAAATTC
ACGGTTGTGGTGGCGACGAAGCGACACCACGTTCGTTTCTTCCCCCACCCGAAACAGGGGGACCGTAACGGCAAT
GCTCTTCCCGGCACTCTGGTGGAGAAAGAAGTCACGCATCCGTTCATGCTCGACTTTTATCTATGCAGCCACGTT
GCGATCCAAGGAACGGCCCGCCCGGTTCACTACCATGTTCTTTTGGACGAGATGAACGTTCCGATCAACGAGTTC
CAGAAGATGATTTACCACCAGTGCTACTCGTACGCGAGATCAACCACGCCTGTCTCGCTGCACCCGGCCGTCTAC
TACGCCCATCTTGCGGGCAACCGAGCCAGATCGCACGAGAACGTGTACACGAGCCAGGGCTTCCGATCCGGTGCC
AAGGGGCACGAGGTGATTCGCGACAAGGTGGCCAAGGGCATCTCGATGGGGAGCATTGCTCGCGGCACGGAGGCG
CCGCAGCTGCTTGTGCTGGGCGGCCAGCCCGAGCCGGAGAAGGGCCCGGTCGACGGAGAGATGCGACAACGCGAC
TTTTTCCGCAGCACCATGTGGTACATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail