Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4788
Gene name
LocationContig_2412:684..1657
Strand-
Gene length (bp)973
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 6.4E-18 146 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 2 212 4.0E-12
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 106 209 3.0E-07
sp|A5D787|M17L2_BOVIN Mpv17-like protein 2 OS=Bos taurus GN=MPV17L2 PE=2 SV=1 50 213 4.0E-07
sp|Q6DIY8|M17L2_XENTR Mpv17-like protein 2 OS=Xenopus tropicalis GN=mpv17l2 PE=2 SV=1 50 212 5.0E-07
sp|Q567V2|M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens GN=MPV17L2 PE=1 SV=2 50 212 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 2 212 4.0E-12
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 106 209 3.0E-07
sp|A5D787|M17L2_BOVIN Mpv17-like protein 2 OS=Bos taurus GN=MPV17L2 PE=2 SV=1 50 213 4.0E-07
sp|Q6DIY8|M17L2_XENTR Mpv17-like protein 2 OS=Xenopus tropicalis GN=mpv17l2 PE=2 SV=1 50 212 5.0E-07
sp|Q567V2|M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens GN=MPV17L2 PE=1 SV=2 50 212 2.0E-06
sp|Q66GV0|MPV17_XENLA Protein Mpv17 OS=Xenopus laevis GN=mpv17 PE=2 SV=2 76 212 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 126 148 22
2 163 185 22
3 192 211 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4788
MPSPIAAATLQAAALATASNLCAQLLDAHRNQDAPGGSSLLPFAKHPPPPSPGLDLRQLARFVALALLTTPPNYL
WQQQLERVFPARPPPPPPRDIELRAVAADDDDDVPRRPPPLSVRNTLAKWFVDCIVLGALANTLAFLLLMGLLKG
QPAPLIWRNVRTETVPIIVAGYKIWPVASIVSFVFVPVHRRIVFLSFVGLLWGIYLSLVAARV*
Coding >Hirsu2|4788
ATGCCGTCGCCGATCGCGGCGGCGACGCTGCAGGCTGCTGCGCTGGCCACGGCCTCGAATTTGTGTGCGCAGCTG
CTCGACGCGCACCGGAACCAGGACGCACCAGGCGGCAGCAGCCTCCTCCCCTTCGCCAAACACCCGCCTCCGCCG
TCGCCGGGCCTCGACCTGCGCCAGCTGGCCCGCTTCGTCGCCCTGGCCCTGCTGACGACGCCGCCCAACTACCTG
TGGCAGCAGCAGCTGGAGCGCGTCTTCCCGGCGCGCCCGCCGCCGCCGCCGCCGCGCGACATCGAGCTGCGAGCC
GTCGCCGCCGACGACGACGACGACGTGCCGCGCCGCCCGCCGCCGCTGAGCGTCCGCAACACCCTGGCCAAGTGG
TTCGTCGACTGCATCGTCCTCGGCGCCCTGGCCAACACGCTGGCCTTTCTGCTGCTCATGGGCCTGCTCAAGGGC
CAGCCTGCGCCGCTGATCTGGCGCAATGTCCGGACGGAGACGGTCCCGATCATCGTGGCGGGGTACAAGATCTGG
CCGGTTGCGTCCATCGTCAGCTTCGTCTTTGTGCCGGTCCATCGGCGCATTGTCTTCCTGAGCTTTGTCGGCTTG
CTGTGGGGGATTTACTTGAGTCTTGTGGCCGCTAGGGTCTGA
Transcript >Hirsu2|4788
ATGCCGTCGCCGATCGCGGCGGCGACGCTGCAGGCTGCTGCGCTGGCCACGGCCTCGAATTTGTGTGCGCAGCTG
CTCGACGCGCACCGGAACCAGGACGCACCAGGCGGCAGCAGCCTCCTCCCCTTCGCCAAACACCCGCCTCCGCCG
TCGCCGGGCCTCGACCTGCGCCAGCTGGCCCGCTTCGTCGCCCTGGCCCTGCTGACGACGCCGCCCAACTACCTG
TGGCAGCAGCAGCTGGAGCGCGTCTTCCCGGCGCGCCCGCCGCCGCCGCCGCCGCGCGACATCGAGCTGCGAGCC
GTCGCCGCCGACGACGACGACGACGTGCCGCGCCGCCCGCCGCCGCTGAGCGTCCGCAACACCCTGGCCAAGTGG
TTCGTCGACTGCATCGTCCTCGGCGCCCTGGCCAACACGCTGGCCTTTCTGCTGCTCATGGGCCTGCTCAAGGGC
CAGCCTGCGCCGCTGATCTGGCGCAATGTCCGGACGGAGACGGTCCCGATCATCGTGGCGGGGTACAAGATCTGG
CCGGTTGCGTCCATCGTCAGCTTCGTCTTTGTGCCGGTCCATCGGCGCATTGTCTTCCTGAGCTTTGTCGGCTTG
CTGTGGGGGATTTACTTGAGTCTTGTGGCCGCTAGGGTCTGA
Gene >Hirsu2|4788
ATGCCGTCGCCGATCGCGGCGGCGACGCTGCAGGCTGCTGCGCTGGCCACGGCCTCGAATTTGTGTGCGCAGCTG
CTCGACGCGCACCGGAACCAGGTCCGTCTTTCTCTCGAGATCGATCCCCCGTTTTGCAGCTGGGCCTGGCGCGAG
AGGAGGCCGTGGAGCTCTACTCGGCTCGAGGGGAGACGTGAAGCCACGTCCGTCACGAGCAAGGACGAGAAGCCA
GGTCAAGTGACGAGGAAAGACGTGAAGCTATACCCGGCACGAGACAAGACGTGAAGCCACGTCCGTCACGAGAGA
CAGCCGAAGCTACACATCCAGCGCGAGAAAAGAGCGAGCCGTTGCTGAAGCGAAACAACAACAATGACAGGACGC
ACCAGGCGGCAGCAGCCTCCTCCCCTTCGCCAAACACCCGCCTCCGCCGTCGCCGGGCCTCGACCTGCGCCAGCT
GGCCCGCTTCGTCGCCCTGGCCCTGCTGACGACGCCGCCCAACTACCTGTGGCAGCAGCAGCTGGAGCGCGTCTT
CCCGGCGCGCCCGCCGCCGCCGCCGCCGCGCGACATCGAGCTGCGAGCCGTCGCCGCCGACGACGACGACGACGT
GCCGCGCCGCCCGCCGCCGCTGAGCGTCCGCAACACCCTGGCCAAGTGGTTCGTCGACTGCATCGTCCTCGGCGC
CCTGGCCAACACGCTGGCCTTTCTGCTGCTCATGGGCCTGCTCAAGGGCCAGCCTGCGCCGCTGATCTGGCGCAA
TGTCCGGACGGTGAGGGAGCCCCGGGTCTGGGGAGAGGGTGTGTGTGCTGATGGGTTCCGGCTCTAGGAGACGGT
CCCGATCATCGTGGCGGGGTACAAGATCTGGCCGGTTGCGTCCATCGTCAGCTTCGTCTTTGTGCCGGTCCATCG
GCGCATTGTCTTCCTGAGCTTTGTCGGCTTGCTGTGGGGGATTTACTTGAGTCTTGTGGCCGCTAGGGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail