Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4777
Gene name
LocationContig_241:797..3262
Strand-
Gene length (bp)2465
Transcript length (bp)2400
Coding sequence length (bp)2400
Protein length (aa) 800

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13688 Reprolysin_5 Metallo-peptidase family M12 2.0E-55 268 473
PF13583 Reprolysin_4 Metallo-peptidase family M12B Reprolysin-like 3.6E-46 268 484
PF13574 Reprolysin_2 Metallo-peptidase family M12B Reprolysin-like 7.1E-45 293 484
PF00200 Disintegrin Disintegrin 2.5E-17 513 589
PF13582 Reprolysin_3 Metallo-peptidase family M12B Reprolysin-like 5.0E-10 295 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WQ08|ADMB_ASPFU Disintegrin and metalloproteinase domain-containing protein B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ADM-B PE=3 SV=2 1 720 0.0E+00
sp|C5FUK3|ADMB_ARTOC Disintegrin and metalloproteinase domain-containing protein B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=ADM-B PE=3 SV=1 1 768 0.0E+00
sp|D4DCV9|ADMB_TRIVH Disintegrin and metalloproteinase domain-containing protein B OS=Trichophyton verrucosum (strain HKI 0517) GN=ADM-B PE=3 SV=2 1 749 0.0E+00
sp|D4B1G0|ADMB_ARTBC Disintegrin and metalloproteinase domain-containing protein B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ADM-B PE=3 SV=2 1 749 0.0E+00
sp|O13766|MDE10_SCHPO Zinc metalloprotease mde10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde10 PE=1 SV=1 214 675 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WQ08|ADMB_ASPFU Disintegrin and metalloproteinase domain-containing protein B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ADM-B PE=3 SV=2 1 720 0.0E+00
sp|C5FUK3|ADMB_ARTOC Disintegrin and metalloproteinase domain-containing protein B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=ADM-B PE=3 SV=1 1 768 0.0E+00
sp|D4DCV9|ADMB_TRIVH Disintegrin and metalloproteinase domain-containing protein B OS=Trichophyton verrucosum (strain HKI 0517) GN=ADM-B PE=3 SV=2 1 749 0.0E+00
sp|D4B1G0|ADMB_ARTBC Disintegrin and metalloproteinase domain-containing protein B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ADM-B PE=3 SV=2 1 749 0.0E+00
sp|O13766|MDE10_SCHPO Zinc metalloprotease mde10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde10 PE=1 SV=1 214 675 3.0E-66
sp|Q2QA02|VM3_CRODD Zinc metalloproteinase-disintegrin-like OS=Crotalus durissus durissus PE=2 SV=1 220 680 1.0E-31
sp|Q9XSL6|ADA28_MACFA Disintegrin and metalloproteinase domain-containing protein 28 OS=Macaca fascicularis GN=ADAM28 PE=2 SV=1 284 619 1.0E-30
sp|Q90282|VM3VB_CROAT Zinc metalloproteinase-disintegrin-like VAP2B OS=Crotalus atrox PE=1 SV=1 209 680 2.0E-30
sp|C9E1R8|VM3V3_CROVV Zinc metalloproteinase-disintegrin-like VMP-III OS=Crotalus viridis viridis PE=2 SV=1 209 680 2.0E-30
sp|A4PBQ9|VM3VA_CROAT Zinc metalloproteinase-disintegrin-like VAP2A OS=Crotalus atrox PE=1 SV=1 209 680 1.0E-29
sp|Q9UKQ2|ADA28_HUMAN Disintegrin and metalloproteinase domain-containing protein 28 OS=Homo sapiens GN=ADAM28 PE=2 SV=3 286 619 2.0E-29
sp|P0C7B0|VM3H6_GLOBR Zinc metalloproteinase-disintegrin-like brevilysin H6 OS=Gloydius brevicaudus PE=1 SV=2 209 680 8.0E-29
sp|Q61072|ADAM9_MOUSE Disintegrin and metalloproteinase domain-containing protein 9 OS=Mus musculus GN=Adam9 PE=1 SV=2 266 622 8.0E-28
sp|D8VNS0|VM3_CERRY Zinc metalloproteinase-disintegrin-like OS=Cerberus rynchops PE=1 SV=1 269 619 1.0E-27
sp|Q05910|ADAM8_MOUSE Disintegrin and metalloproteinase domain-containing protein 8 OS=Mus musculus GN=Adam8 PE=1 SV=3 213 619 2.0E-27
sp|P30431|VM3JA_BOTJA Zinc metalloproteinase-disintegrin-like jararhagin (Fragment) OS=Bothrops jararaca PE=1 SV=1 209 680 4.0E-27
sp|Q9JI76|ADA21_MOUSE Disintegrin and metalloproteinase domain-containing protein 21 OS=Mus musculus GN=Adam21 PE=2 SV=1 236 619 5.0E-27
sp|P78325|ADAM8_HUMAN Disintegrin and metalloproteinase domain-containing protein 8 OS=Homo sapiens GN=ADAM8 PE=1 SV=2 267 619 9.0E-27
sp|Q2UXQ5|VM3E2_ECHOC Zinc metalloproteinase-disintegrin-like EoVMP2 OS=Echis ocellatus GN=Svmp3-Eoc22 PE=1 SV=1 269 675 1.0E-26
sp|Q8QG88|VM36A_BOTIN Zinc metalloproteinase-disintegrin-like BITM06A OS=Bothrops insularis PE=2 SV=1 199 680 1.0E-26
sp|Q4VM08|VM3VA_MACLB Zinc metalloproteinase-disintegrin-like VLAIP-A OS=Macrovipera lebetina PE=1 SV=1 1 655 1.0E-26
sp|Q9W6M5|VM3AH_DEIAC Zinc metalloproteinase-disintegrin-like acurhagin OS=Deinagkistrodon acutus PE=1 SV=2 209 680 2.0E-26
sp|O93523|VM3BP_BOTJA Zinc metalloproteinase-disintegrin-like bothropasin OS=Bothrops jararaca PE=1 SV=2 199 680 2.0E-26
sp|Q9JLN6|ADA28_MOUSE Disintegrin and metalloproteinase domain-containing protein 28 OS=Mus musculus GN=Adam28 PE=1 SV=3 284 619 2.0E-26
sp|Q13443|ADAM9_HUMAN Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens GN=ADAM9 PE=1 SV=1 266 635 3.0E-26
sp|P0DM90|VM32B_GLOBR Zinc metalloproteinase-disintegrin-like brevilysin H2b OS=Gloydius brevicaudus PE=1 SV=1 269 631 4.0E-26
sp|A8QL49|VM3_BUNMU Zinc metalloproteinase-disintegrin-like BmMP OS=Bungarus multicinctus PE=1 SV=1 42 681 6.0E-26
sp|J3SDW8|VM38_CROAD Zinc metalloproteinase-disintegrin-like 8 OS=Crotalus adamanteus PE=1 SV=1 209 637 6.0E-26
sp|A8QL48|VM3_BUNFA Zinc metalloproteinase-disintegrin-like BfMP (Fragment) OS=Bungarus fasciatus PE=2 SV=1 57 675 6.0E-26
sp|F8RKW0|VM38_DRYCN Zinc metalloproteinase-disintegrin-like MTP8 OS=Drysdalia coronoides PE=1 SV=1 57 657 2.0E-25
sp|P0DM89|VM32A_GLOBR Zinc metalloproteinase-disintegrin-like brevilysin H2a OS=Gloydius brevicaudus PE=1 SV=1 269 631 3.0E-25
sp|F8RKV9|VM39_DRYCN Zinc metalloproteinase-disintegrin-like MTP9 OS=Drysdalia coronoides PE=1 SV=1 57 657 4.0E-25
sp|B8K1W0|VM3DK_DABRR Zinc metalloproteinase-disintegrin-like daborhagin-K OS=Daboia russelii PE=1 SV=1 57 675 4.0E-25
sp|Q9PVK7|VM3_NAJKA Zinc metalloproteinase-disintegrin-like cobrin OS=Naja kaouthia PE=2 SV=1 57 680 7.0E-25
sp|Q2UXR0|VM3E1_ECHOC Zinc metalloproteinase-disintegrin-like Eoc1 OS=Echis ocellatus GN=Svmp3-Eoc1 PE=2 SV=1 274 680 9.0E-25
sp|Q8JIR2|VM3HA_PROFL Zinc metalloproteinase/disintegrin-like HR1a OS=Protobothrops flavoviridis PE=1 SV=1 248 664 1.0E-24
sp|Q92043|VM3AA_CROAT Zinc metalloproteinase-disintegrin-like atrolysin-A (Fragment) OS=Crotalus atrox PE=1 SV=1 268 680 1.0E-24
sp|F8RKW1|VM34_DRYCN Zinc metalloproteinase-disintegrin-like MTP4 OS=Drysdalia coronoides PE=1 SV=1 57 664 2.0E-24
sp|A8QL59|VM3_NAJAT Zinc metalloproteinase-disintegrin-like NaMP OS=Naja atra PE=2 SV=1 267 656 2.0E-24
sp|C5H5D4|VM33_BOTAT Zinc metalloproteinase-disintegrin-like batroxstatin-3 (Fragment) OS=Bothrops atrox PE=2 SV=1 267 619 3.0E-24
sp|Q4VM07|VM3VB_MACLB Zinc metalloproteinase-disintegrin-like VLAIP-B OS=Macrovipera lebetina PE=1 SV=1 267 675 5.0E-24
sp|A3R0T9|VM3_OPHHA Zinc metalloproteinase-disintegrin-like ohanin OS=Ophiophagus hannah PE=1 SV=1 269 657 8.0E-24
sp|Q9UKJ8|ADA21_HUMAN Disintegrin and metalloproteinase domain-containing protein 21 OS=Homo sapiens GN=ADAM21 PE=2 SV=2 281 619 1.0E-23
sp|Q9R160|ADA24_MOUSE Disintegrin and metalloproteinase domain-containing protein 24 OS=Mus musculus GN=Adam24 PE=1 SV=2 286 637 1.0E-23
sp|J3S830|VM33_CROAD Zinc metalloproteinase-disintegrin-like 3a OS=Crotalus adamanteus PE=1 SV=1 209 680 2.0E-23
sp|Q90495|VM3E_ECHCA Zinc metalloproteinase-disintegrin-like ecarin OS=Echis carinatus PE=1 SV=1 269 621 2.0E-23
sp|Q8AWI5|VM3HA_GLOHA Zinc metalloproteinase-disintegrin-like halysase OS=Gloydius halys PE=1 SV=1 209 619 2.0E-23
sp|F8S108|VM34_CROAD Zinc metalloproteinase-disintegrin-like 4a OS=Crotalus adamanteus PE=1 SV=1 209 680 2.0E-23
sp|C9E1S0|VM3V3_AGKPL Zinc metalloproteinase-disintegrin-like VMP-III OS=Agkistrodon piscivorus leucostoma PE=2 SV=1 248 631 3.0E-23
sp|P0DM97|VM25A_BITAR Zinc metalloproteinase-disintegrin BA-5A OS=Bitis arietans PE=2 SV=1 247 598 3.0E-23
sp|Q9DGB9|VM3V1_CROAT Zinc metalloproteinase-disintegrin-like VAP1 OS=Crotalus atrox PE=1 SV=1 209 619 4.0E-23
sp|O43506|ADA20_HUMAN Disintegrin and metalloproteinase domain-containing protein 20 OS=Homo sapiens GN=ADAM20 PE=2 SV=2 269 619 4.0E-23
sp|Q1PS45|VM3AK_DEIAC Zinc metalloproteinase-disintegrin-like agkihagin OS=Deinagkistrodon acutus PE=2 SV=1 209 680 5.0E-23
sp|O42138|VM3AD_AGKCL Zinc metalloproteinase-disintegrin-like ACLD OS=Agkistrodon contortrix laticinctus PE=2 SV=1 213 675 6.0E-23
sp|J3S829|VM32A_CROAD Zinc metalloproteinase-disintegrin-like 2a OS=Crotalus adamanteus PE=1 SV=1 209 631 2.0E-22
sp|J3SDW6|VM32D_CROAD Zinc metalloproteinase-disintegrin-like 2d OS=Crotalus adamanteus PE=1 SV=1 209 631 2.0E-22
sp|P83912|VM2JT_PROJR Zinc metalloproteinase-disintegrin jerdonitin OS=Protobothrops jerdonii PE=1 SV=1 209 587 2.0E-22
sp|Q8AWX7|VM2AG_GLOHA Zinc metalloproteinase-disintegrin agkistin OS=Gloydius halys PE=2 SV=1 269 587 2.0E-22
sp|O77780|ADAM2_BOVIN Disintegrin and metalloproteinase domain-containing protein 2 OS=Bos taurus GN=ADAM2 PE=2 SV=1 261 616 3.0E-22
sp|Q9R159|ADA25_MOUSE Disintegrin and metalloproteinase domain-containing protein 25 OS=Mus musculus GN=Adam25 PE=2 SV=1 347 619 3.0E-22
sp|C9E1R7|VM2V2_CROAT Zinc metalloproteinase-disintegrin VMP-II OS=Crotalus atrox PE=2 SV=1 269 588 3.0E-22
sp|D3TTC2|VM3H_NAJAT Zinc metalloproteinase-disintegrin-like atragin OS=Naja atra PE=1 SV=1 253 680 3.0E-22
sp|O35598|ADA10_MOUSE Disintegrin and metalloproteinase domain-containing protein 10 OS=Mus musculus GN=Adam10 PE=1 SV=2 48 609 3.0E-22
sp|Q6X1T6|VM3E6_ECHOC Zinc metalloproteinase-disintegrin-like EoMP06 (Fragment) OS=Echis ocellatus PE=2 SV=1 220 621 5.0E-22
sp|Q1PBD1|VM2DI_GLOHA Zinc metalloproteinase/disintegrin OS=Gloydius halys PE=2 SV=1 211 587 5.0E-22
sp|Q9H2U9|ADAM7_HUMAN Disintegrin and metalloproteinase domain-containing protein 7 OS=Homo sapiens GN=ADAM7 PE=1 SV=3 256 619 5.0E-22
sp|J9Z332|VM2_CROAD Zinc metalloproteinase-disintegrin VMP-II OS=Crotalus adamanteus PE=2 SV=1 269 587 6.0E-22
sp|Q8UVG0|VM3BE_BOTER Zinc metalloproteinase-disintegrin-like berythractivase OS=Bothrops erythromelas PE=1 SV=1 251 664 6.0E-22
sp|Q98UF9|VM3H3_BOTJA Zinc metalloproteinase-disintegrin-like HF3 OS=Bothrops jararaca PE=1 SV=3 293 680 1.0E-21
sp|Q10749|VM3M1_NAJMO Snake venom metalloproteinase-disintegrin-like mocarhagin OS=Naja mossambica PE=1 SV=3 248 619 1.0E-21
sp|C5H5D2|VM31_BOTAT Zinc metalloproteinase-disintegrin-like batroxstatin-1 OS=Bothrops atrox PE=2 SV=1 267 619 2.0E-21
sp|P20164|VM3HB_PROFL Zinc metalloproteinase-disintegrin-like HR1b OS=Protobothrops flavoviridis PE=1 SV=4 269 675 2.0E-21
sp|J3SBP9|VM28_CROAD Zinc metalloproteinase-disintegrin 8 OS=Crotalus adamanteus PE=1 SV=1 209 587 2.0E-21
sp|D5LMJ3|VM3A_NAJAT Zinc metalloproteinase-disintegrin-like atrase-A OS=Naja atra PE=2 SV=1 253 619 2.0E-21
sp|Q8R534|ADM1B_MOUSE Disintegrin and metalloproteinase domain-containing protein 1b OS=Mus musculus GN=Adam1b PE=1 SV=2 419 616 2.0E-21
sp|Q60411|ADAM2_CAVPO Disintegrin and metalloproteinase domain-containing protein 2 OS=Cavia porcellus GN=ADAM2 PE=2 SV=1 289 617 4.0E-21
sp|Q8JIY1|ADA10_XENLA Disintegrin and metalloproteinase domain-containing protein 10 OS=Xenopus laevis GN=adam10 PE=2 SV=1 263 610 4.0E-21
sp|Q811Q4|ADA29_MOUSE Disintegrin and metalloproteinase domain-containing protein 29 OS=Mus musculus GN=Adam29 PE=2 SV=1 268 619 5.0E-21
sp|Q9UKF2|ADA30_HUMAN Disintegrin and metalloproteinase domain-containing protein 30 OS=Homo sapiens GN=ADAM30 PE=2 SV=2 382 619 5.0E-21
sp|Q9R1V4|ADA11_MOUSE Disintegrin and metalloproteinase domain-containing protein 11 OS=Mus musculus GN=Adam11 PE=1 SV=2 460 619 8.0E-21
sp|Q9UKF5|ADA29_HUMAN Disintegrin and metalloproteinase domain-containing protein 29 OS=Homo sapiens GN=ADAM29 PE=1 SV=3 270 619 8.0E-21
sp|Q28660|ADAM2_RABIT Disintegrin and metalloproteinase domain-containing protein 2 OS=Oryctolagus cuniculus GN=ADAM2 PE=2 SV=1 292 619 9.0E-21
sp|Q923W9|ADA33_MOUSE Disintegrin and metalloproteinase domain-containing protein 33 OS=Mus musculus GN=Adam33 PE=1 SV=3 350 619 1.0E-20
sp|Q9BZ11|ADA33_HUMAN Disintegrin and metalloproteinase domain-containing protein 33 OS=Homo sapiens GN=ADAM33 PE=1 SV=2 276 619 2.0E-20
sp|Q1PHZ4|VM3B1_BOTJR Zinc metalloproteinase-disintegrin-like BjussuMP-1 (Fragment) OS=Bothrops jararacussu PE=1 SV=1 270 675 2.0E-20
sp|C5H5D1|VM31_CRODC Zinc metalloproteinase-disintegrin-like crotastatin (Fragment) OS=Crotalus durissus cascavella PE=2 SV=1 267 619 2.0E-20
sp|Q28475|ADAM7_MACFA Disintegrin and metalloproteinase domain-containing protein 7 OS=Macaca fascicularis GN=ADAM7 PE=2 SV=1 269 619 3.0E-20
sp|P82942|VM3K_NAJKA Hemorrhagic metalloproteinase-disintegrin-like kaouthiagin OS=Naja kaouthia PE=1 SV=1 286 680 3.0E-20
sp|O75078|ADA11_HUMAN Disintegrin and metalloproteinase domain-containing protein 11 OS=Homo sapiens GN=ADAM11 PE=2 SV=3 460 619 4.0E-20
sp|Q7LZ61|VM3CX_DABSI Coagulation factor X-activating enzyme heavy chain OS=Daboia siamensis PE=1 SV=2 289 622 4.0E-20
sp|Q9VAC5|ADA17_DROME ADAM 17-like protease OS=Drosophila melanogaster GN=Tace PE=2 SV=2 68 736 4.0E-20
sp|O75077|ADA23_HUMAN Disintegrin and metalloproteinase domain-containing protein 23 OS=Homo sapiens GN=ADAM23 PE=1 SV=1 460 619 5.0E-20
sp|O14672|ADA10_HUMAN Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens GN=ADAM10 PE=1 SV=1 419 609 5.0E-20
sp|Q61824|ADA12_MOUSE Disintegrin and metalloproteinase domain-containing protein 12 OS=Mus musculus GN=Adam12 PE=1 SV=2 268 619 6.0E-20
sp|Q10741|ADA10_BOVIN Disintegrin and metalloproteinase domain-containing protein 10 OS=Bos taurus GN=ADAM10 PE=1 SV=1 420 609 6.0E-20
sp|Q698K8|VM2L4_GLOBR Zinc metalloproteinase/disintegrin (Fragment) OS=Gloydius brevicaudus PE=1 SV=3 266 587 6.0E-20
sp|Q99965|ADAM2_HUMAN Disintegrin and metalloproteinase domain-containing protein 2 OS=Homo sapiens GN=ADAM2 PE=2 SV=2 288 616 7.0E-20
sp|Q10743|ADA10_RAT Disintegrin and metalloproteinase domain-containing protein 10 (Fragment) OS=Rattus norvegicus GN=Adam10 PE=2 SV=1 419 609 8.0E-20
sp|Q90ZI3|VM3H1_PROFL Zinc metalloproteinase-disintegrin-like HV1 OS=Protobothrops flavoviridis PE=1 SV=1 267 619 1.0E-19
sp|Q90WC0|VM2HS_GLOBR Zinc metalloproteinase/disintegrin (Fragment) OS=Gloydius brevicaudus PE=1 SV=1 266 587 1.0E-19
sp|Q076D1|VM31_CRODU Zinc metalloproteinase-disintegrin-like crotastatin OS=Crotalus durissus terrificus PE=2 SV=1 267 619 1.0E-19
sp|O88839|ADA15_MOUSE Disintegrin and metalloproteinase domain-containing protein 15 OS=Mus musculus GN=Adam15 PE=1 SV=2 381 619 2.0E-19
sp|P97776|ADA18_RAT Disintegrin and metalloproteinase domain-containing protein 18 (Fragment) OS=Rattus norvegicus GN=Adam18 PE=2 SV=1 460 676 2.0E-19
sp|Q9R158|AD26A_MOUSE Disintegrin and metalloproteinase domain-containing protein 26A OS=Mus musculus GN=Adam26a PE=2 SV=2 381 619 2.0E-19
sp|Q7T046|VM3CX_MACLB Coagulation factor X-activating enzyme heavy chain OS=Macrovipera lebetina PE=1 SV=1 1 656 2.0E-19
sp|Q63180|ADAM7_RAT Disintegrin and metalloproteinase domain-containing protein 7 OS=Rattus norvegicus GN=Adam7 PE=1 SV=1 269 621 3.0E-19
sp|Q9PSZ3|ADA11_XENLA Disintegrin and metalloproteinase domain-containing protein 11 (Fragment) OS=Xenopus laevis GN=adam11 PE=2 SV=1 454 619 3.0E-19
sp|Q9R1V7|ADA23_MOUSE Disintegrin and metalloproteinase domain-containing protein 23 OS=Mus musculus GN=Adam23 PE=1 SV=1 460 619 4.0E-19
sp|P0C6E8|VM3G1_TRIGA Zinc metalloproteinase/disintegrin (Fragment) OS=Trimeresurus gramineus PE=1 SV=1 269 622 4.0E-19
sp|Q9QYV0|ADA15_RAT Disintegrin and metalloproteinase domain-containing protein 15 OS=Rattus norvegicus GN=Adam15 PE=2 SV=2 381 619 4.0E-19
sp|P0DM87|VM2_TRIST Zinc metalloproteinase-disintegrin stejnitin OS=Trimeresurus stejnegeri PE=1 SV=1 209 587 5.0E-19
sp|E9NW27|VM2P2_PROMU Zinc metalloproteinase/disintegrin PMMP-2 OS=Protobothrops mucrosquamatus PE=2 SV=1 45 587 5.0E-19
sp|Q7SZE0|VM2SA_GLOSA Zinc metalloproteinase/disintegrin OS=Gloydius saxatilis PE=2 SV=1 269 587 5.0E-19
sp|Q28478|ADAM2_MACFA Disintegrin and metalloproteinase domain-containing protein 2 OS=Macaca fascicularis GN=ADAM2 PE=2 SV=2 291 616 6.0E-19
sp|Q95194|ADA18_MACFA Disintegrin and metalloproteinase domain-containing protein 18 OS=Macaca fascicularis GN=ADAM18 PE=2 SV=1 292 619 6.0E-19
sp|Q13444|ADA15_HUMAN Disintegrin and metalloproteinase domain-containing protein 15 OS=Homo sapiens GN=ADAM15 PE=1 SV=4 381 619 7.0E-19
sp|D3TTC1|VM3KL_NAJAT Zinc metalloproteinase-disintegrin-like kaouthiagin-like OS=Naja atra PE=1 SV=1 286 680 1.0E-18
sp|P86092|VM3LB_BOTLC Zinc metalloproteinase leucurolysin-B (Fragment) OS=Bothrops leucurus PE=1 SV=1 371 622 1.0E-18
sp|O35227|ADAM7_MOUSE Disintegrin and metalloproteinase domain-containing protein 7 OS=Mus musculus GN=Adam7 PE=2 SV=2 269 619 1.0E-18
sp|Q9Y3Q7|ADA18_HUMAN Disintegrin and metalloproteinase domain-containing protein 18 OS=Homo sapiens GN=ADAM18 PE=2 SV=1 350 619 1.0E-18
sp|O42596|ADA22_XENLA Disintegrin and metalloproteinase domain-containing protein 22 OS=Xenopus laevis GN=adam22 PE=2 SV=2 44 619 2.0E-18
sp|Q98SP2|VM2J2_BOTJA Zinc metalloproteinase/disintegrin OS=Bothrops jararaca PE=1 SV=1 209 587 2.0E-18
sp|Q2LD49|VM3TM_TRIST Zinc metalloproteinase-disintegrin-like TSV-DM OS=Trimeresurus stejnegeri PE=1 SV=1 45 677 3.0E-18
sp|Q60472|ADAM5_CAVPO Disintegrin and metalloproteinase domain-containing protein 5 OS=Cavia porcellus GN=ADAM5 PE=2 SV=1 350 619 4.0E-18
sp|D6PXE8|VM3B_NAJAT Zinc metalloproteinase-disintegrin-like atrase-B OS=Naja atra PE=1 SV=1 253 680 4.0E-18
sp|Q9P0K1|ADA22_HUMAN Disintegrin and metalloproteinase domain-containing protein 22 OS=Homo sapiens GN=ADAM22 PE=1 SV=1 460 619 4.0E-18
sp|Q9YI19|VM2MC_GLOBR Zinc metalloproteinase/disintegrin OS=Gloydius brevicaudus PE=1 SV=1 269 587 6.0E-18
sp|P0C6B6|VM2AL_TRIAB Zinc metalloproteinase homolog-disintegrin albolatin OS=Trimeresurus albolabris PE=1 SV=1 211 587 6.0E-18
sp|Q9R157|ADA18_MOUSE Disintegrin and metalloproteinase domain-containing protein 18 OS=Mus musculus GN=Adam18 PE=1 SV=2 347 676 1.0E-17
sp|C5H5D6|VM32_LACMR Zinc metalloproteinase-disintegrin-like lachestatin-2 OS=Lachesis muta rhombeata PE=2 SV=1 267 680 1.0E-17
sp|P14530|VM2HA_PROFL Zinc metalloproteinase/disintegrin OS=Protobothrops flavoviridis PE=1 SV=3 269 587 1.0E-17
sp|Q5BK84|ADAM5_RAT Disintegrin and metalloproteinase domain-containing protein 5 OS=Rattus norvegicus GN=Adam5 PE=2 SV=1 334 623 2.0E-17
sp|C5H5D5|VM31_LACMR Zinc metalloproteinase-disintegrin-like lachestatin-1 OS=Lachesis muta rhombeata PE=2 SV=1 267 680 2.0E-17
sp|C5H5D3|VM32_BOTAT Zinc metalloproteinase-disintegrin-like batroxstatin-2 (Fragment) OS=Bothrops atrox PE=2 SV=1 267 675 2.0E-17
sp|Q5XUW8|VM2IA_BOTIN Zinc metalloproteinase/disintegrin OS=Bothrops insularis PE=1 SV=1 267 590 2.0E-17
sp|Q90Y44|VM3H_GLOHA Disintegrin-like halysetin OS=Gloydius halys PE=1 SV=1 507 619 2.0E-17
sp|O73795|VM2MB_GLOBR Zinc metalloproteinase/disintegrin OS=Gloydius brevicaudus PE=2 SV=2 266 587 2.0E-17
sp|Q9R1V6|ADA22_MOUSE Disintegrin and metalloproteinase domain-containing protein 22 OS=Mus musculus GN=Adam22 PE=1 SV=2 448 619 3.0E-17
sp|Q9PVK9|VM2MD_GLOBR Zinc metalloproteinase/disintegrin OS=Gloydius brevicaudus PE=2 SV=1 269 587 4.0E-17
sp|Q28483|ADAM5_MACFA Disintegrin and metalloproteinase domain-containing protein 5 OS=Macaca fascicularis GN=ADAM5 PE=1 SV=1 249 616 4.0E-17
sp|Q63202|ADAM2_RAT Disintegrin and metalloproteinase domain-containing protein 2 OS=Rattus norvegicus GN=Adam2 PE=1 SV=2 352 664 5.0E-17
sp|Q3HTN1|VM3SA_TRIST Zinc metalloproteinase-disintegrin-like stejnihagin-A OS=Trimeresurus stejnegeri PE=2 SV=1 209 681 5.0E-17
sp|Q805F6|VM2AB_AGKCO Zinc metalloproteinase/disintegrin OS=Agkistrodon contortrix contortrix PE=1 SV=1 248 587 5.0E-17
sp|O93518|VM3S5_GLOBR Zinc metalloproteinase/disintegrin (Fragment) OS=Gloydius brevicaudus PE=2 SV=1 499 619 7.0E-17
sp|Q9IAB0|VM2CO_AGKCO Zinc metalloproteinase/disintegrin OS=Agkistrodon contortrix contortrix PE=1 SV=1 248 587 7.0E-17
sp|Q60813|ADM1A_MOUSE Disintegrin and metalloproteinase domain-containing protein 1a OS=Mus musculus GN=Adam1a PE=2 SV=3 419 616 1.0E-16
sp|C9E1R9|VM2V2_CROVV Zinc metalloproteinase/disintegrin VMP-II OS=Crotalus viridis viridis PE=2 SV=1 213 590 1.0E-16
sp|Q072L5|VM2_BOTAS Zinc metalloproteinase/disintegrin OS=Bothrops asper PE=2 SV=1 267 590 1.0E-16
sp|Q7SZD9|VM2US_GLOUS Zinc metalloproteinase/disintegrin ussurin OS=Gloydius ussuriensis PE=2 SV=1 269 587 1.0E-16
sp|O43184|ADA12_HUMAN Disintegrin and metalloproteinase domain-containing protein 12 OS=Homo sapiens GN=ADAM12 PE=1 SV=3 267 619 1.0E-16
sp|P34182|VM2AE_CROAT Zinc metalloproteinase/disintegrin OS=Crotalus atrox PE=1 SV=1 266 587 1.0E-16
sp|P30403|VM2RH_CALRH Zinc metalloproteinase/disintegrin OS=Calloselasma rhodostoma PE=1 SV=2 209 587 2.0E-16
sp|P15503|VM2TA_TRIGA Zinc metalloproteinase/disintegrin OS=Trimeresurus gramineus PE=1 SV=3 269 587 2.0E-16
sp|Q7ZZS9|VM2J_PROJR Zinc metalloproteinase/disintegrin OS=Protobothrops jerdonii PE=1 SV=1 269 587 2.0E-16
sp|O57413|VM2T3_PROMU Zinc metalloproteinase/disintegrin OS=Protobothrops mucrosquamatus PE=1 SV=1 269 587 3.0E-16
sp|P18619|VM2FL_PROFL Zinc metalloproteinase/disintegrin OS=Protobothrops flavoviridis PE=1 SV=2 45 587 3.0E-16
sp|P0C6E4|VM2JN_PROJR Zinc metalloproteinase/disintegrin OS=Protobothrops jerdonii PE=1 SV=1 45 587 3.0E-16
sp|P17349|VM2E1_PROEL Zinc metalloproteinase/disintegrin OS=Protobothrops elegans PE=1 SV=2 269 587 5.0E-16
sp|P0DJ87|VM3L_BOTLC Zinc metalloproteinase-disintegrin-like leucurogin (Fragment) OS=Bothrops leucurus PE=2 SV=1 507 589 6.0E-16
sp|E9NW26|VM2P1_PROMU Zinc metalloproteinase/disintegrin PMMP-1 OS=Protobothrops mucrosquamatus PE=2 SV=1 221 587 8.0E-16
sp|Q8K410|ADA32_MOUSE Disintegrin and metalloproteinase domain-containing protein 32 OS=Mus musculus GN=Adam32 PE=1 SV=3 274 619 1.0E-15
sp|Q805F4|VM2PB_AGKPI Zinc metalloproteinase/disintegrin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 269 587 1.0E-15
sp|Q3HTN2|VM3SB_TRIST Zinc metalloproteinase-disintegrin-like stejnihagin-B OS=Trimeresurus stejnegeri PE=2 SV=1 269 619 1.0E-15
sp|Q3TTE0|ADAM5_MOUSE Disintegrin and metalloproteinase domain-containing protein 5 OS=Mus musculus GN=Adam5 PE=1 SV=1 507 623 2.0E-15
sp|P70505|ADAM1_RAT Disintegrin and metalloproteinase domain-containing protein 1 OS=Rattus norvegicus GN=Adam1 PE=2 SV=1 419 616 2.0E-15
sp|P0C6R9|VM3A_BOTAL Zinc metalloproteinase-disintegrin-like alternagin (Fragment) OS=Bothrops alternatus PE=1 SV=2 507 598 2.0E-15
sp|C9E1S1|VM2V2_AGKPL Zinc metalloproteinase/disintegrin VMP-II OS=Agkistrodon piscivorus leucostoma PE=2 SV=1 269 587 5.0E-15
sp|Q0NZY0|VM3B1_BOTJA Zinc metalloproteinase-disintegrin-like bothrojarin-1 (Fragment) OS=Bothrops jararaca PE=2 SV=1 507 619 9.0E-15
sp|Q0NZX9|VM3B2_BOTJA Zinc metalloproteinase-disintegrin-like bothrojarin-2 (Fragment) OS=Bothrops jararaca PE=1 SV=1 507 622 1.0E-14
sp|C0LZJ5|VM3LC_MACLN Disintegrin-like leberagin-C OS=Macrovipera lebetina transmediterranea PE=1 SV=1 507 664 2.0E-14
sp|Q90YA6|VM2E2_PROEL Zinc metalloproteinase/disintegrin OS=Protobothrops elegans PE=1 SV=1 269 587 3.0E-14
sp|Q0NZX8|VM3B3_BOTJA Zinc metalloproteinase-disintegrin-like bothrojarin-3 (Fragment) OS=Bothrops jararaca PE=1 SV=1 507 619 5.0E-14
sp|U5PZ28|VM2H1_BOTLA Zinc metalloproteinase-disintegrin BlatH1 OS=Bothriechis lateralis PE=1 SV=1 269 587 6.0E-14
sp|Q9PSN7|VM3H1_CRORU Snake venom metalloproteinase HT-1 (Fragment) OS=Crotalus ruber ruber PE=1 SV=1 507 622 7.0E-14
sp|Q90220|VM2H1_GLOHA Zinc metalloproteinase/disintegrin OS=Gloydius halys PE=2 SV=1 269 587 1.0E-13
sp|Q0NZX7|VM3B4_BOTJA Zinc metalloproteinase-disintegrin-like bothrojarin-4 (Fragment) OS=Bothrops jararaca PE=2 SV=1 507 598 2.0E-13
sp|Q60718|ADAM2_MOUSE Disintegrin and metalloproteinase domain-containing protein 2 OS=Mus musculus GN=Adam2 PE=1 SV=2 352 630 4.0E-13
sp|P0C6E3|VM2B1_AGKBI Zinc metalloproteinase-disintegrin bilitoxin-1 OS=Agkistrodon bilineatus PE=1 SV=1 282 587 1.0E-12
sp|O93517|VM3S4_GLOBR Zinc metalloproteinase/disintegrin (Fragment) OS=Gloydius brevicaudus PE=2 SV=1 507 588 1.0E-12
sp|Q0NZX6|VM2JR_BOTJA Zinc metalloproteinase-disintegrin jararin (Fragment) OS=Bothrops jararaca PE=2 SV=1 420 587 2.0E-12
sp|P78536|ADA17_HUMAN Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens GN=ADAM17 PE=1 SV=1 419 715 3.0E-12
sp|Q8TC27|ADA32_HUMAN Disintegrin and metalloproteinase domain-containing protein 32 OS=Homo sapiens GN=ADAM32 PE=1 SV=2 276 619 3.0E-12
sp|Q9PWJ0|VM2A2_DEIAC Zinc metalloproteinase/disintegrin OS=Deinagkistrodon acutus GN=wbfib4 PE=1 SV=1 220 587 4.0E-12
sp|P31989|VM2JC_BOTJA Zinc metalloproteinase/disintegrin (Fragment) OS=Bothrops jararaca PE=1 SV=2 422 590 7.0E-12
sp|Q9Z0F8|ADA17_MOUSE Disintegrin and metalloproteinase domain-containing protein 17 OS=Mus musculus GN=Adam17 PE=1 SV=3 419 609 3.0E-11
sp|Q9Z1K9|ADA17_RAT Disintegrin and metalloproteinase domain-containing protein 17 OS=Rattus norvegicus GN=Adam17 PE=1 SV=1 419 609 3.0E-11
sp|Q90221|VM2H2_GLOHA Zinc metalloproteinase/disintegrin (Fragment) OS=Gloydius halys PE=2 SV=1 508 587 2.0E-10
sp|O93515|VM2S3_GLOBR Zinc metalloproteinase-disintegrin salmosin-3 (Fragment) OS=Gloydius brevicaudus PE=2 SV=1 507 587 3.0E-10
sp|Q0NZX5|VM2JA_BOTJA Disintegrin jarastatin (Fragment) OS=Bothrops jararaca PE=1 SV=1 508 587 3.0E-10
sp|P17497|VM2_BITAR Disintegrin bitistatin OS=Bitis arietans PE=1 SV=1 507 587 3.0E-10
sp|Q801Z4|VM2_BOTAL Disintegrin DisBa-01 OS=Bothrops alternatus PE=1 SV=2 508 587 6.0E-10
sp|Q9R0X2|ADEC1_MOUSE ADAM DEC1 OS=Mus musculus GN=Adamdec1 PE=2 SV=1 276 545 8.0E-10
sp|A2CJE4|VM3C_CROAT Zinc metalloproteinase-disintegrin-like catroriarin (Fragment) OS=Crotalus atrox PE=2 SV=1 529 616 1.0E-09
sp|A2CJE3|VM3V_CROVV Zinc metalloproteinase-disintegrin-like viristiarin (Fragment) OS=Crotalus viridis viridis PE=2 SV=1 529 616 1.0E-09
sp|A2CJE2|VM3S_CROSS Zinc metalloproteinase-disintegrin-like scutiarin (Fragment) OS=Crotalus scutulatus scutulatus PE=2 SV=1 529 616 1.0E-09
sp|O15204|ADEC1_HUMAN ADAM DEC1 OS=Homo sapiens GN=ADAMDEC1 PE=1 SV=2 276 545 5.0E-09
sp|P62383|VM2G_TRIGA Disintegrin trigramin-gamma OS=Trimeresurus gramineus PE=1 SV=1 513 587 1.0E-08
sp|P62384|VM2G_TRIAB Disintegrin albolabrin OS=Trimeresurus albolabris PE=1 SV=1 513 587 1.0E-08
sp|O93516|VM2S2_GLOBR Zinc metalloproteinase/disintegrin (Fragment) OS=Gloydius brevicaudus PE=2 SV=1 508 587 3.0E-08
sp|P21858|VM2_GLOBL Disintegrin halysin OS=Gloydius blomhoffii PE=1 SV=1 513 587 4.0E-08
sp|P31985|VM2I_CROOC Disintegrin cereberin OS=Crotalus oreganus cerberus PE=1 SV=1 513 590 5.0E-08
sp|P17495|VM2B_TRIGA Disintegrin trigramin-beta-2 OS=Trimeresurus gramineus PE=1 SV=1 513 587 7.0E-08
sp|Q805F7|DIDA_AGKCO Disintegrin acostatin-alpha OS=Agkistrodon contortrix contortrix PE=1 SV=1 529 587 8.0E-08
sp|P31990|VM2I_LACMU Disintegrin lachesin OS=Lachesis muta muta PE=1 SV=1 513 587 9.0E-08
sp|Q9DGH6|VM2_GLOHA Disintegrin saxatilin OS=Gloydius halys PE=1 SV=1 513 587 1.0E-07
sp|P31982|VM2I_CROCC Disintegrin cerastin OS=Crotalus cerastes cerastes PE=1 SV=1 513 587 1.0E-07
sp|P18618|VM2_BOTAT Disintegrin batroxostatin OS=Bothrops atrox PE=1 SV=2 513 590 1.0E-07
sp|P31988|VM2_BOTCO Disintegrin cotiarin OS=Bothrops cotiara PE=1 SV=1 513 590 1.0E-07
sp|C9E1S2|DIDA_AGKPL Disintegrin subunit alpha OS=Agkistrodon piscivorus leucostoma PE=2 SV=1 529 587 2.0E-07
sp|P31981|VM2I_CROBA Disintegrin basilicin OS=Crotalus basiliscus PE=1 SV=1 514 587 2.0E-07
sp|P22827|VM2I_SISMB Disintegrin barbourin OS=Sistrurus miliarius barbouri PE=1 SV=1 513 587 3.0E-07
sp|P0DJ43|VM3_MICIK Zinc metalloproteinase-disintegrin-like mikarin (Fragments) OS=Micropechis ikaheka PE=1 SV=1 507 618 3.0E-07
sp|P0C7X7|VM212_CROSS Disintegrin mojastin-2 OS=Crotalus scutulatus scutulatus PE=1 SV=1 513 587 5.0E-07
sp|P22828|VM2I_SISCT Disintegrin tergeminin OS=Sistrurus catenatus tergeminus PE=1 SV=1 513 587 6.0E-07
sp|P31986|VM2I_CROOL Disintegrin lutosin OS=Crotalus oreganus lutosus PE=1 SV=1 513 587 6.0E-07
sp|P31984|VM2I_CROMM Disintegrin molossin OS=Crotalus molossus molossus PE=1 SV=1 513 587 7.0E-07
sp|P31987|VM2I_CROVV Disintegrin viridin OS=Crotalus viridis viridis PE=1 SV=1 514 587 8.0E-07
sp|P16338|VM2_AGKPI Disintegrin applaggin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 513 587 1.0E-06
sp|P23323|VM2C_PROFL Disintegrin CTF-II OS=Protobothrops flavoviridis PE=1 SV=1 511 587 2.0E-06
sp|P68521|VM2I_CRODD Disintegrin durissin OS=Crotalus durissus durissus PE=1 SV=1 514 587 2.0E-06
sp|P68520|VM2IC_CROAT Disintegrin crotatroxin OS=Crotalus atrox PE=1 SV=1 514 587 2.0E-06
sp|Q7LZT4|VM2I2_GLOUS Disintegrin ussuristatin-2 OS=Gloydius ussuriensis PE=1 SV=1 513 587 3.0E-06
sp|P0C7X6|VM212_CROHD Disintegrin horrdistatin-2 OS=Crotalus horridus PE=1 SV=1 515 587 4.0E-06
sp|Q98995|VM2L2_MACLB Zinc metalloproteinase/disintegrin OS=Macrovipera lebetina PE=1 SV=1 248 593 6.0E-06
sp|Q805F5|DIDA_AGKPI Disintegrin piscivostatin-alpha OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 528 587 6.0E-06
sp|P21859|VM2T_PROFL Disintegrin triflavin OS=Protobothrops flavoviridis PE=1 SV=1 515 587 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 694 716 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4777
MVALRSIVTALAGATLWARSTTAHSIRRNPIGYTTFVRDADINTPSHRVHSHSKFDLTFTLHNGREKFRLVLDPN
HDIIPDDFTISHLDSDGSVRQVYKTPRSDHRVFRGHAFVERPDMSGWSKAGWARITVHQDGDSPVFTGAFRVDGD
NHHIETADQYLKLRGDDDARPQGLPPHGRPLVVWRDSDILDPDSDANYHVDLKRSLSDEPTCLADSLDFNADFNA
RLQSQNWLARTDARTLFGRQLNPFGSRSSLSRSTGNTRGCPSTRRVALVGIATDCTYSQDFDNNKTAIQNNIVDM
VNKASELYESSFNISLSILNLTISDKNCPASASPQAPWNLGCSDSFNLTDRLSAFSQWRSQFNDRNAYWTLMSKC
RTKEAVGLAWQGQLCRSGANTTSDNSVSSSANVVVRLDGSEWQVFAHETGHTFGAFHDCDSNLCATQETCCPLSS
DQCDANRKFIMNPTTGANMNSFSPCSIGNICSGLQSSVNSNCLTANKNVNSILGSKCGNGIVESGEDCDCGTDQE
CRNNKCCDAKTCKFTSGSVCDPSNESCCTGQCQFANRGTVCRGSTGECDPEETCTGDHAGCPDDKHKEDGDACGQ
GLNCASGQCTSRDLQCKAMASSFRGFNSTRACPGDSCRMSCASADIGSDDCFMPNQNFLDGTMCGGGGKCNNGSC
KGSSTIKEIGNWIQDHKGVFIPIVSVVGGLLAIAILSSIISGIRRRIRRRRLMKAAKLNSWPSYNGPGGGGGPPG
RRDPRRQWSDSSGVPMFNGYNNPYPPPPPPPFAEQPNRWGEPRRSMRYA*
Coding >Hirsu2|4777
ATGGTCGCACTTCGGTCTATTGTTACCGCCCTCGCCGGCGCCACCCTCTGGGCTCGGTCGACAACTGCTCACTCG
ATTAGACGAAACCCTATTGGCTACACGACGTTTGTCCGCGACGCTGATATTAATACGCCTTCCCACCGGGTACAT
TCGCATTCTAAATTCGACCTAACCTTTACTCTGCATAATGGACGTGAGAAATTCAGGCTCGTGCTGGATCCGAAC
CACGACATCATCCCCGACGACTTCACCATCAGCCACCTCGACTCGGACGGATCGGTTCGCCAGGTCTACAAGACG
CCCCGCTCCGACCACCGCGTCTTTCGCGGCCATGCCTTCGTCGAGCGCCCCGACATGTCCGGCTGGTCCAAGGCT
GGCTGGGCACGCATCACGGTCCACCAAGACGGAGACAGCCCCGTCTTTACCGGCGCCTTTCGCGTCGACGGCGAC
AACCACCACATCGAGACCGCCGATCAATACCTCAAGCTGAGAGGCGACGACGACGCCCGGCCCCAGGGCCTGCCG
CCCCACGGCCGCCCCCTCGTCGTCTGGCGCGACTCCGACATCCTCGACCCCGACAGCGACGCCAACTACCACGTC
GATCTGAAGCGCAGCCTCTCCGACGAGCCCACCTGCCTCGCCGACTCCCTCGACTTCAACGCCGACTTCAACGCC
AGGCTGCAGAGCCAGAACTGGCTGGCACGCACCGACGCCCGCACCCTCTTCGGCCGCCAACTCAACCCCTTCGGC
AGCCGCTCGAGCCTCAGCCGCAGCACTGGAAACACCCGAGGCTGCCCCTCGACGAGGAGGGTGGCGCTCGTCGGC
ATCGCCACCGACTGCACCTACTCGCAGGACTTCGACAACAACAAGACGGCCATCCAGAACAACATCGTCGACATG
GTCAACAAGGCGTCGGAGCTGTATGAGAGCAGCTTCAACATCTCCCTGAGCATCCTCAACCTCACCATTAGCGAC
AAGAACTGCCCCGCCTCCGCCTCTCCCCAGGCGCCCTGGAACCTCGGATGCAGCGACAGCTTCAACCTGACGGAC
CGGCTCAGCGCCTTTTCCCAGTGGCGAAGCCAGTTCAACGACCGCAACGCATACTGGACCCTCATGTCCAAGTGC
CGCACCAAGGAAGCCGTCGGGCTGGCCTGGCAGGGACAGTTGTGCCGCTCGGGGGCCAACACGACGTCTGACAAC
TCGGTATCCTCGTCGGCCAATGTCGTCGTCCGGCTCGACGGCTCCGAGTGGCAGGTCTTTGCCCACGAGACGGGC
CACACGTTCGGTGCCTTCCACGACTGCGACAGCAATCTCTGCGCCACGCAGGAGACGTGCTGTCCCCTGTCGAGC
GACCAGTGCGACGCCAACCGCAAGTTCATCATGAACCCGACGACGGGCGCCAACATGAACAGCTTCTCGCCCTGC
AGCATCGGCAACATATGCTCCGGGCTCCAGTCCAGCGTCAACAGCAACTGCCTGACGGCCAACAAGAACGTCAAC
TCGATCCTGGGCAGCAAGTGCGGCAACGGCATCGTCGAGAGCGGCGAGGACTGCGACTGCGGCACCGACCAGGAG
TGCCGCAACAACAAGTGCTGCGACGCCAAGACGTGCAAGTTCACGAGTGGCTCCGTCTGCGACCCGTCCAACGAG
TCGTGTTGCACCGGGCAGTGCCAGTTCGCCAACCGGGGGACCGTCTGCCGGGGCAGCACGGGCGAGTGCGACCCG
GAGGAGACGTGCACCGGCGACCACGCCGGCTGCCCGGACGACAAGCACAAGGAAGACGGCGACGCGTGCGGCCAG
GGGCTCAACTGCGCCTCGGGCCAGTGCACGTCGCGCGACCTCCAGTGCAAGGCCATGGCGAGCAGCTTCCGCGGC
TTCAACAGCACGCGCGCCTGCCCCGGCGACAGCTGCCGCATGTCGTGCGCGTCGGCCGACATTGGGTCGGACGAC
TGCTTCATGCCGAACCAGAACTTCCTGGACGGCACCATGTGCGGCGGCGGCGGCAAGTGCAACAACGGCTCCTGC
AAGGGCTCGTCGACGATCAAGGAGATTGGCAACTGGATCCAGGACCACAAGGGCGTCTTCATCCCCATCGTGTCG
GTTGTGGGCGGGCTGCTCGCCATCGCCATCCTGTCGAGCATCATCAGCGGCATCCGGCGCCGCATCCGGCGCCGG
CGGCTGATGAAGGCGGCCAAGCTGAACAGCTGGCCGTCGTACAACGGGCCCGGGGGCGGCGGCGGGCCTCCGGGG
CGGCGGGACCCGCGGCGGCAGTGGAGCGACTCGTCGGGCGTGCCCATGTTCAACGGCTACAACAACCCGTACCCG
CCGCCGCCGCCGCCGCCGTTTGCGGAGCAGCCGAATCGATGGGGGGAACCGCGGCGGAGCATGCGGTACGCATAG
Transcript >Hirsu2|4777
ATGGTCGCACTTCGGTCTATTGTTACCGCCCTCGCCGGCGCCACCCTCTGGGCTCGGTCGACAACTGCTCACTCG
ATTAGACGAAACCCTATTGGCTACACGACGTTTGTCCGCGACGCTGATATTAATACGCCTTCCCACCGGGTACAT
TCGCATTCTAAATTCGACCTAACCTTTACTCTGCATAATGGACGTGAGAAATTCAGGCTCGTGCTGGATCCGAAC
CACGACATCATCCCCGACGACTTCACCATCAGCCACCTCGACTCGGACGGATCGGTTCGCCAGGTCTACAAGACG
CCCCGCTCCGACCACCGCGTCTTTCGCGGCCATGCCTTCGTCGAGCGCCCCGACATGTCCGGCTGGTCCAAGGCT
GGCTGGGCACGCATCACGGTCCACCAAGACGGAGACAGCCCCGTCTTTACCGGCGCCTTTCGCGTCGACGGCGAC
AACCACCACATCGAGACCGCCGATCAATACCTCAAGCTGAGAGGCGACGACGACGCCCGGCCCCAGGGCCTGCCG
CCCCACGGCCGCCCCCTCGTCGTCTGGCGCGACTCCGACATCCTCGACCCCGACAGCGACGCCAACTACCACGTC
GATCTGAAGCGCAGCCTCTCCGACGAGCCCACCTGCCTCGCCGACTCCCTCGACTTCAACGCCGACTTCAACGCC
AGGCTGCAGAGCCAGAACTGGCTGGCACGCACCGACGCCCGCACCCTCTTCGGCCGCCAACTCAACCCCTTCGGC
AGCCGCTCGAGCCTCAGCCGCAGCACTGGAAACACCCGAGGCTGCCCCTCGACGAGGAGGGTGGCGCTCGTCGGC
ATCGCCACCGACTGCACCTACTCGCAGGACTTCGACAACAACAAGACGGCCATCCAGAACAACATCGTCGACATG
GTCAACAAGGCGTCGGAGCTGTATGAGAGCAGCTTCAACATCTCCCTGAGCATCCTCAACCTCACCATTAGCGAC
AAGAACTGCCCCGCCTCCGCCTCTCCCCAGGCGCCCTGGAACCTCGGATGCAGCGACAGCTTCAACCTGACGGAC
CGGCTCAGCGCCTTTTCCCAGTGGCGAAGCCAGTTCAACGACCGCAACGCATACTGGACCCTCATGTCCAAGTGC
CGCACCAAGGAAGCCGTCGGGCTGGCCTGGCAGGGACAGTTGTGCCGCTCGGGGGCCAACACGACGTCTGACAAC
TCGGTATCCTCGTCGGCCAATGTCGTCGTCCGGCTCGACGGCTCCGAGTGGCAGGTCTTTGCCCACGAGACGGGC
CACACGTTCGGTGCCTTCCACGACTGCGACAGCAATCTCTGCGCCACGCAGGAGACGTGCTGTCCCCTGTCGAGC
GACCAGTGCGACGCCAACCGCAAGTTCATCATGAACCCGACGACGGGCGCCAACATGAACAGCTTCTCGCCCTGC
AGCATCGGCAACATATGCTCCGGGCTCCAGTCCAGCGTCAACAGCAACTGCCTGACGGCCAACAAGAACGTCAAC
TCGATCCTGGGCAGCAAGTGCGGCAACGGCATCGTCGAGAGCGGCGAGGACTGCGACTGCGGCACCGACCAGGAG
TGCCGCAACAACAAGTGCTGCGACGCCAAGACGTGCAAGTTCACGAGTGGCTCCGTCTGCGACCCGTCCAACGAG
TCGTGTTGCACCGGGCAGTGCCAGTTCGCCAACCGGGGGACCGTCTGCCGGGGCAGCACGGGCGAGTGCGACCCG
GAGGAGACGTGCACCGGCGACCACGCCGGCTGCCCGGACGACAAGCACAAGGAAGACGGCGACGCGTGCGGCCAG
GGGCTCAACTGCGCCTCGGGCCAGTGCACGTCGCGCGACCTCCAGTGCAAGGCCATGGCGAGCAGCTTCCGCGGC
TTCAACAGCACGCGCGCCTGCCCCGGCGACAGCTGCCGCATGTCGTGCGCGTCGGCCGACATTGGGTCGGACGAC
TGCTTCATGCCGAACCAGAACTTCCTGGACGGCACCATGTGCGGCGGCGGCGGCAAGTGCAACAACGGCTCCTGC
AAGGGCTCGTCGACGATCAAGGAGATTGGCAACTGGATCCAGGACCACAAGGGCGTCTTCATCCCCATCGTGTCG
GTTGTGGGCGGGCTGCTCGCCATCGCCATCCTGTCGAGCATCATCAGCGGCATCCGGCGCCGCATCCGGCGCCGG
CGGCTGATGAAGGCGGCCAAGCTGAACAGCTGGCCGTCGTACAACGGGCCCGGGGGCGGCGGCGGGCCTCCGGGG
CGGCGGGACCCGCGGCGGCAGTGGAGCGACTCGTCGGGCGTGCCCATGTTCAACGGCTACAACAACCCGTACCCG
CCGCCGCCGCCGCCGCCGTTTGCGGAGCAGCCGAATCGATGGGGGGAACCGCGGCGGAGCATGCGGTACGCATAG
Gene >Hirsu2|4777
ATGGTCGCACTTCGGTCTATTGTTACCGCCCTCGCCGGCGCCACCCTCTGGGCTCGGTCGACAACTGGTACGCCC
TCGACCATAACGCTCACATTGTTGCCTACGCCGCTGACCTTACCCGCCTCTCGCCAGCTCACTCGATTAGACGAA
ACCCTATTGGCTACACGACGTTTGTCCGCGACGCTGATATTAATACGCCTTCCCACCGGGTACATTCGCATTCTA
AATTCGACCTAACCTTTACTCTGCATAATGGACGTGAGAAATTCAGGCTCGTGCTGGATCCGAACCACGACATCA
TCCCCGACGACTTCACCATCAGCCACCTCGACTCGGACGGATCGGTTCGCCAGGTCTACAAGACGCCCCGCTCCG
ACCACCGCGTCTTTCGCGGCCATGCCTTCGTCGAGCGCCCCGACATGTCCGGCTGGTCCAAGGCTGGCTGGGCAC
GCATCACGGTCCACCAAGACGGAGACAGCCCCGTCTTTACCGGCGCCTTTCGCGTCGACGGCGACAACCACCACA
TCGAGACCGCCGATCAATACCTCAAGCTGAGAGGCGACGACGACGCCCGGCCCCAGGGCCTGCCGCCCCACGGCC
GCCCCCTCGTCGTCTGGCGCGACTCCGACATCCTCGACCCCGACAGCGACGCCAACTACCACGTCGATCTGAAGC
GCAGCCTCTCCGACGAGCCCACCTGCCTCGCCGACTCCCTCGACTTCAACGCCGACTTCAACGCCAGGCTGCAGA
GCCAGAACTGGCTGGCACGCACCGACGCCCGCACCCTCTTCGGCCGCCAACTCAACCCCTTCGGCAGCCGCTCGA
GCCTCAGCCGCAGCACTGGAAACACCCGAGGCTGCCCCTCGACGAGGAGGGTGGCGCTCGTCGGCATCGCCACCG
ACTGCACCTACTCGCAGGACTTCGACAACAACAAGACGGCCATCCAGAACAACATCGTCGACATGGTCAACAAGG
CGTCGGAGCTGTATGAGAGCAGCTTCAACATCTCCCTGAGCATCCTCAACCTCACCATTAGCGACAAGAACTGCC
CCGCCTCCGCCTCTCCCCAGGCGCCCTGGAACCTCGGATGCAGCGACAGCTTCAACCTGACGGACCGGCTCAGCG
CCTTTTCCCAGTGGCGAAGCCAGTTCAACGACCGCAACGCATACTGGACCCTCATGTCCAAGTGCCGCACCAAGG
AAGCCGTCGGGCTGGCCTGGCAGGGACAGTTGTGCCGCTCGGGGGCCAACACGACGTCTGACAACTCGGTATCCT
CGTCGGCCAATGTCGTCGTCCGGCTCGACGGCTCCGAGTGGCAGGTCTTTGCCCACGAGACGGGCCACACGTTCG
GTGCCTTCCACGACTGCGACAGCAATCTCTGCGCCACGCAGGAGACGTGCTGTCCCCTGTCGAGCGACCAGTGCG
ACGCCAACCGCAAGTTCATCATGAACCCGACGACGGGCGCCAACATGAACAGCTTCTCGCCCTGCAGCATCGGCA
ACATATGCTCCGGGCTCCAGTCCAGCGTCAACAGCAACTGCCTGACGGCCAACAAGAACGTCAACTCGATCCTGG
GCAGCAAGTGCGGCAACGGCATCGTCGAGAGCGGCGAGGACTGCGACTGCGGCACCGACCAGGAGTGCCGCAACA
ACAAGTGCTGCGACGCCAAGACGTGCAAGTTCACGAGTGGCTCCGTCTGCGACCCGTCCAACGAGTCGTGTTGCA
CCGGGCAGTGCCAGTTCGCCAACCGGGGGACCGTCTGCCGGGGCAGCACGGGCGAGTGCGACCCGGAGGAGACGT
GCACCGGCGACCACGCCGGCTGCCCGGACGACAAGCACAAGGAAGACGGCGACGCGTGCGGCCAGGGGCTCAACT
GCGCCTCGGGCCAGTGCACGTCGCGCGACCTCCAGTGCAAGGCCATGGCGAGCAGCTTCCGCGGCTTCAACAGCA
CGCGCGCCTGCCCCGGCGACAGCTGCCGCATGTCGTGCGCGTCGGCCGACATTGGGTCGGACGACTGCTTCATGC
CGAACCAGAACTTCCTGGACGGCACCATGTGCGGCGGCGGCGGCAAGTGCAACAACGGCTCCTGCAAGGGCTCGT
CGACGATCAAGGAGATTGGCAACTGGATCCAGGACCACAAGGGCGTCTTCATCCCCATCGTGTCGGTTGTGGGCG
GGCTGCTCGCCATCGCCATCCTGTCGAGCATCATCAGCGGCATCCGGCGCCGCATCCGGCGCCGGCGGCTGATGA
AGGCGGCCAAGCTGAACAGCTGGCCGTCGTACAACGGGCCCGGGGGCGGCGGCGGGCCTCCGGGGCGGCGGGACC
CGCGGCGGCAGTGGAGCGACTCGTCGGGCGTGCCCATGTTCAACGGCTACAACAACCCGTACCCGCCGCCGCCGC
CGCCGCCGTTTGCGGAGCAGCCGAATCGATGGGGGGAACCGCGGCGGAGCATGCGGTACGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail