Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4773
Gene name
LocationContig_2408:112..1624
Strand+
Gene length (bp)1512
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.0E-15 92 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL81 PE=1 SV=3 50 470 4.0E-62
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 1 336 1.0E-24
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 76 385 9.0E-21
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 91 417 1.0E-09
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 91 402 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL81 PE=1 SV=3 50 470 4.0E-62
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 1 336 1.0E-24
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 76 385 9.0E-21
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 91 417 1.0E-09
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 91 402 3.0E-07
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 62 311 2.0E-06
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 76 381 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0008270 zinc ion binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0005488 binding No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0019438 aromatic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0043169 cation binding No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0090304 nucleic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4773
LGLDPATHAEHVGPTDYRDPILLDLHRPPPPSSSHGSPAAAAAAPPQLARRLDDQTIFIVRPDETAASEAQRITD
LDAVEAAVRPLGPTLVDLYFRIVHPSFPILHKDVFISKHRLSHRHFAPSLLAAVYLVALDWQLYDSVLAGRQTEA
IPDAAALEKLAERTMSQDMRRPKLSTVETGLLLLQRHRRAAEPADLPTSRRAFAAQLFAMAQDLGLHLDCSTWSI
PAWEVGLRRRLAWALYAHDRWGALVHGRPFLFHEDDWDVRPCVDSDFPELNPRAAVVDVDVRLGWELFLRHIELA
RLLSEVLPVFYGPKATRAGGTLDRLGVTGALELAQPFVMQLREWRSALPDTLRLQSKQRGKLCANGSLHLAFASI
EIAIHRALVRTLTPRTSEALRNTVRSAAREKLCAATELLTSLEPEHTAAFWARAAAHQVAHVASLAALLWATAES
TDEMAWCAARVDDLRWALRVRGSAAPFAREALRLVEHDIGGFGVVRNGAERLK*
Coding >Hirsu2|4773
CTGGGCCTGGACCCTGCCACGCACGCCGAGCACGTCGGCCCGACCGACTACCGCGATCCGATTCTGCTCGACCTG
CACCGTCCTCCGCCCCCTTCCTCCTCCCACGGCTCGCCCGCCGCCGCCGCCGCCGCCCCGCCTCAGCTCGCCCGC
CGCCTCGACGACCAGACCATCTTCATCGTCCGTCCCGACGAGACGGCAGCCTCCGAAGCCCAGCGCATTACCGAT
CTCGATGCCGTCGAGGCCGCCGTCCGGCCGCTCGGGCCCACACTCGTCGATCTCTACTTTCGCATCGTACATCCC
AGCTTCCCCATCCTGCACAAGGATGTCTTCATCAGCAAGCACCGCCTTTCCCACCGTCACTTCGCCCCCTCGCTC
CTGGCCGCCGTCTATCTCGTCGCGCTGGACTGGCAGCTTTACGACAGCGTGCTGGCCGGCCGCCAGACTGAGGCG
ATCCCCGACGCCGCCGCCCTCGAGAAGCTCGCCGAGCGTACCATGAGCCAGGACATGCGCCGGCCCAAGCTCAGC
ACCGTCGAGACGGGCCTGCTGCTTCTACAGCGACACCGCCGTGCCGCCGAGCCCGCCGACCTGCCGACCTCGAGA
CGCGCCTTTGCGGCACAGCTCTTCGCCATGGCCCAGGACCTCGGCCTCCATCTCGATTGCAGCACCTGGTCCATC
CCCGCCTGGGAGGTCGGCTTGCGGAGGAGGCTCGCCTGGGCGTTGTATGCGCATGACCGTTGGGGGGCCTTGGTC
CACGGACGCCCTTTTCTCTTCCACGAGGACGACTGGGACGTTAGGCCCTGCGTCGACTCCGACTTCCCCGAGCTG
AACCCGCGCGCGGCCGTTGTCGACGTCGACGTCCGCCTCGGCTGGGAGCTGTTCCTCCGCCACATAGAGCTGGCC
CGTCTGCTCTCCGAGGTTCTTCCCGTCTTCTACGGTCCAAAGGCGACGCGCGCGGGCGGCACGCTCGATCGCCTC
GGCGTGACGGGCGCCCTCGAGCTGGCGCAGCCATTCGTCATGCAGCTACGCGAATGGCGCTCGGCCCTGCCCGAC
ACCTTGCGGCTGCAGAGCAAGCAGCGAGGGAAGCTCTGCGCCAACGGGTCGCTGCACCTGGCCTTCGCCTCCATC
GAGATCGCCATCCACCGCGCCCTCGTCCGCACCCTCACGCCGCGCACCTCCGAGGCCCTCCGCAACACCGTCCGC
TCGGCGGCCCGGGAGAAGCTGTGCGCCGCGACGGAGCTCCTCACCTCCCTCGAGCCCGAGCATACGGCCGCGTTC
TGGGCCCGGGCGGCCGCCCACCAGGTGGCCCACGTCGCGTCGCTGGCCGCGCTCCTCTGGGCCACGGCCGAGTCG
ACGGACGAGATGGCCTGGTGCGCCGCCCGCGTCGACGACCTTCGCTGGGCCCTGCGCGTCCGCGGCTCCGCGGCG
CCCTTTGCCCGGGAGGCCCTGCGCCTGGTCGAGCACGACATTGGCGGCTTCGGCGTTGTGAGGAACGGTGCCGAG
AGACTAAAGTGA
Transcript >Hirsu2|4773
CTGGGCCTGGACCCTGCCACGCACGCCGAGCACGTCGGCCCGACCGACTACCGCGATCCGATTCTGCTCGACCTG
CACCGTCCTCCGCCCCCTTCCTCCTCCCACGGCTCGCCCGCCGCCGCCGCCGCCGCCCCGCCTCAGCTCGCCCGC
CGCCTCGACGACCAGACCATCTTCATCGTCCGTCCCGACGAGACGGCAGCCTCCGAAGCCCAGCGCATTACCGAT
CTCGATGCCGTCGAGGCCGCCGTCCGGCCGCTCGGGCCCACACTCGTCGATCTCTACTTTCGCATCGTACATCCC
AGCTTCCCCATCCTGCACAAGGATGTCTTCATCAGCAAGCACCGCCTTTCCCACCGTCACTTCGCCCCCTCGCTC
CTGGCCGCCGTCTATCTCGTCGCGCTGGACTGGCAGCTTTACGACAGCGTGCTGGCCGGCCGCCAGACTGAGGCG
ATCCCCGACGCCGCCGCCCTCGAGAAGCTCGCCGAGCGTACCATGAGCCAGGACATGCGCCGGCCCAAGCTCAGC
ACCGTCGAGACGGGCCTGCTGCTTCTACAGCGACACCGCCGTGCCGCCGAGCCCGCCGACCTGCCGACCTCGAGA
CGCGCCTTTGCGGCACAGCTCTTCGCCATGGCCCAGGACCTCGGCCTCCATCTCGATTGCAGCACCTGGTCCATC
CCCGCCTGGGAGGTCGGCTTGCGGAGGAGGCTCGCCTGGGCGTTGTATGCGCATGACCGTTGGGGGGCCTTGGTC
CACGGACGCCCTTTTCTCTTCCACGAGGACGACTGGGACGTTAGGCCCTGCGTCGACTCCGACTTCCCCGAGCTG
AACCCGCGCGCGGCCGTTGTCGACGTCGACGTCCGCCTCGGCTGGGAGCTGTTCCTCCGCCACATAGAGCTGGCC
CGTCTGCTCTCCGAGGTTCTTCCCGTCTTCTACGGTCCAAAGGCGACGCGCGCGGGCGGCACGCTCGATCGCCTC
GGCGTGACGGGCGCCCTCGAGCTGGCGCAGCCATTCGTCATGCAGCTACGCGAATGGCGCTCGGCCCTGCCCGAC
ACCTTGCGGCTGCAGAGCAAGCAGCGAGGGAAGCTCTGCGCCAACGGGTCGCTGCACCTGGCCTTCGCCTCCATC
GAGATCGCCATCCACCGCGCCCTCGTCCGCACCCTCACGCCGCGCACCTCCGAGGCCCTCCGCAACACCGTCCGC
TCGGCGGCCCGGGAGAAGCTGTGCGCCGCGACGGAGCTCCTCACCTCCCTCGAGCCCGAGCATACGGCCGCGTTC
TGGGCCCGGGCGGCCGCCCACCAGGTGGCCCACGTCGCGTCGCTGGCCGCGCTCCTCTGGGCCACGGCCGAGTCG
ACGGACGAGATGGCCTGGTGCGCCGCCCGCGTCGACGACCTTCGCTGGGCCCTGCGCGTCCGCGGCTCCGCGGCG
CCCTTTGCCCGGGAGGCCCTGCGCCTGGTCGAGCACGACATTGGCGGCTTCGGCGTTGTGAGGAACGGTGCCGAG
AGACTAAAGTGA
Gene >Hirsu2|4773
CTGGGCCTGGACCCTGCCACGCACGCCGAGCACGTCGGCCCGACCGACTACCGCGATCCGATTCTGCTCGACCTG
CACCGTCCTCCGCCCCCTTCCTCCTCCCACGGCTCGCCCGCCGCCGCCGCCGCCGCCCCGCCTCAGCTCGCCCGC
CGCCTCGACGACCAGACCATCTTCATCGTCCGTCCCGACGAGACGGCAGCCTCCGAAGCCCAGCGCATTACCGAT
CTCGATGCCGTCGAGGCCGCCGTCCGGCCGCTCGGGCCCACACTCGTCGATCTCTACTTTCGCATCGTACATCCC
AGCTTCCCCATCCTGCACAAGGATGTCTTCATCAGCAAGCACCGCCTTTCCCACCGTCACTTCGCCCCCTCGCTC
CTGGCCGCCGTCTATCTCGTCGCGCTGGACTGGCAGCTTTACGACAGCGTGCTGGCCGGCCGCCAGACTGAGGCG
ATCCCCGACGCCGCCGCCCTCGAGAAGCTCGCCGAGCGTACCATGAGCCAGGACATGCGCCGGCCCAAGCTCAGC
ACCGTCGAGACGGGCCTGCTGCTTCTACAGCGACACCGCCGTGCCGCCGAGCCCGCCGACCTGCCGACCTCGAGA
CGCGCCTTTGCGGCACAGCTCTTCGCCATGGCCCAGGACCTCGGCCTCCATCTCGATTGCAGCACCTGGTCCATC
CCCGCCTGGGAGGTCGGCTTGCGGAGGAGGCTCGCCTGGGCGTTGTATGCGCATGACCGTTGGGGGGCCTTGGTC
CACGGACGCCCTTTTCTCTTCCACGAGGACGACTGGGACGTTAGGCCCTGCGTCGACTCCGACTTCCCCGAGCTG
AACCCGCGCGCGGCCGTTGTCGACGTCGACGTCCGCCTCGGCTGGGAGCTGTTCCTCCGCCACATAGAGCTGGCC
CGTCTGCTCTCCGAGGTTCTTCCCGTCTTCTACGGTCCAAAGGCGACGCGCGCGGGCGGCACGCTCGATCGCCTC
GGCGTGACGGGCGCCCTCGAGCTGGCGCAGCCATTCGTCATGCAGCTACGCGAATGGCGCTCGGCCCTGCCCGAC
ACCTTGCGGCTGCAGAGCAAGCAGCGAGGGAAGCTCTGCGCCAACGGGTCGCTGCACCTGGCCTTCGCCTCCATC
GAGATCGCCATCCACCGCGCCCTCGTCCGCACCCTCACGCCGCGCACCTCCGAGGCCCTCCGCAACACCGTCCGC
TCGGCGGCCCGGGAGAAGCTGTGCGCCGCGACGGAGCTCCTCACCTCCCTCGAGCCCGAGCATACGGCCGCGTTC
TGGGCCCGGGCGGCCGCCCACCAGGTGGCCCACGTCGCGTCGCTGGCCGCGCTCCTCTGGGCCACGGCCGAGTCG
ACGGACGAGATGGCCTGGTGCGCCGCCCGCGTCGACGACCTTCGCTGGGCCCTGCGCGTCCGCGGCTCCGCGGCG
CCCTTTGCCCGGGAGGCCCTGCGCCTGGTCGAGCACGACATTGGCGGCTTCGGCGTTGTGAGGAACGGTGCCGAG
AGACTAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail