Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4768
Gene name
LocationContig_2404:6..318
Strand+
Gene length (bp)312
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.5E-12 50 88
PF13639 zf-RING_2 Ring finger domain 6.1E-12 50 89
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.3E-11 48 91
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 9.7E-11 51 88
PF13445 zf-RING_UBOX RING-type zinc-finger 2.5E-09 51 86
PF14634 zf-RING_5 zinc-RING finger domain 5.7E-08 50 90
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 2.3E-07 51 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05568|PEX10_YEAST Peroxisome biogenesis factor 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX10 PE=1 SV=1 49 101 6.0E-18
sp|Q00940|PEX10_PICAN Peroxisome biogenesis factor 10 OS=Pichia angusta GN=PEX10 PE=3 SV=1 33 101 3.0E-17
sp|Q9UUF0|PEX10_SCHPO Peroxisome biogenesis factor 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pas4 PE=3 SV=1 23 101 4.0E-15
sp|O60683|PEX10_HUMAN Peroxisome biogenesis factor 10 OS=Homo sapiens GN=PEX10 PE=1 SV=1 51 101 9.0E-14
sp|Q8HXW8|PEX10_MACFA Peroxisome biogenesis factor 10 OS=Macaca fascicularis GN=PEX10 PE=2 SV=1 51 101 9.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05568|PEX10_YEAST Peroxisome biogenesis factor 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX10 PE=1 SV=1 49 101 6.0E-18
sp|Q00940|PEX10_PICAN Peroxisome biogenesis factor 10 OS=Pichia angusta GN=PEX10 PE=3 SV=1 33 101 3.0E-17
sp|Q9UUF0|PEX10_SCHPO Peroxisome biogenesis factor 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pas4 PE=3 SV=1 23 101 4.0E-15
sp|O60683|PEX10_HUMAN Peroxisome biogenesis factor 10 OS=Homo sapiens GN=PEX10 PE=1 SV=1 51 101 9.0E-14
sp|Q8HXW8|PEX10_MACFA Peroxisome biogenesis factor 10 OS=Macaca fascicularis GN=PEX10 PE=2 SV=1 51 101 9.0E-14
sp|B1AUE5|PEX10_MOUSE Peroxisome biogenesis factor 10 OS=Mus musculus GN=Pex10 PE=2 SV=1 51 101 4.0E-13
sp|Q9SYU4|PEX10_ARATH Peroxisome biogenesis factor 10 OS=Arabidopsis thaliana GN=PEX10 PE=1 SV=1 50 89 8.0E-13
sp|Q54S31|PEX10_DICDI Peroxisome biogenesis factor 10 OS=Dictyostelium discoideum GN=pex10 PE=3 SV=2 50 100 4.0E-12
sp|Q9P3U8|YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC548.05c PE=3 SV=1 38 95 6.0E-10
sp|Q92265|PEX10_PICPA Peroxisome biogenesis factor 10 OS=Komagataella pastoris GN=PEX10 PE=1 SV=1 33 88 1.0E-09
sp|P93030|RMA2_ARATH E3 ubiquitin-protein ligase RMA2 OS=Arabidopsis thaliana GN=RMA2 PE=1 SV=1 51 100 3.0E-09
sp|Q6R567|RMA1_CAPAN E3 ubiquitin-protein ligase RMA1H1 OS=Capsicum annuum GN=RMA1H1 PE=1 SV=1 15 100 4.0E-08
sp|Q8GUK7|RMA3_ARATH E3 ubiquitin-protein ligase RMA3 OS=Arabidopsis thaliana GN=RMA3 PE=1 SV=1 51 100 4.0E-08
sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 6 100 6.0E-08
sp|O74747|RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp18 PE=3 SV=1 50 89 1.0E-07
sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 50 100 2.0E-07
sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 50 100 2.0E-07
sp|Q99942|RNF5_HUMAN E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1 50 100 2.0E-07
sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 50 100 5.0E-07
sp|Q09463|RNF5_CAEEL RING finger protein 5 OS=Caenorhabditis elegans GN=rnf-5 PE=1 SV=1 18 100 6.0E-07
sp|Q5ZIR9|RN185_CHICK E3 ubiquitin-protein ligase RNF185 OS=Gallus gallus GN=RNF185 PE=2 SV=1 50 100 6.0E-07
sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 50 100 6.0E-07
sp|Q5RFK9|RN185_PONAB E3 ubiquitin-protein ligase RNF185 OS=Pongo abelii GN=RNF185 PE=2 SV=1 50 100 6.0E-07
sp|Q6NTV1|RNFT1_XENLA RING finger and transmembrane domain-containing protein 1 OS=Xenopus laevis GN=rnft1 PE=2 SV=2 51 89 6.0E-07
sp|Q6FPI4|RAD18_CANGA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD18 PE=3 SV=1 50 95 8.0E-07
sp|Q7YR34|TRI26_PANTR Tripartite motif-containing protein 26 OS=Pan troglodytes GN=TRIM26 PE=3 SV=1 51 100 1.0E-06
sp|Q7YRV4|RO52_BOVIN E3 ubiquitin-protein ligase TRIM21 OS=Bos taurus GN=TRIM21 PE=2 SV=1 51 103 1.0E-06
sp|Q12899|TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens GN=TRIM26 PE=1 SV=1 51 100 1.0E-06
sp|Q99PN3|TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus GN=Trim26 PE=2 SV=3 51 100 1.0E-06
sp|Q6PC78|RN185_DANRE E3 ubiquitin-protein ligase RNF185 OS=Danio rerio GN=rnf185 PE=2 SV=1 50 100 1.0E-06
sp|P62603|TRI26_RAT Tripartite motif-containing protein 26 OS=Rattus norvegicus GN=Trim26 PE=3 SV=1 51 100 1.0E-06
sp|Q9UPQ7|PZRN3_HUMAN E3 ubiquitin-protein ligase PDZRN3 OS=Homo sapiens GN=PDZRN3 PE=1 SV=2 50 101 2.0E-06
sp|Q69ZS0|PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus GN=Pdzrn3 PE=1 SV=3 50 101 2.0E-06
sp|P68907|PZRN3_RAT E3 ubiquitin-protein ligase PDZRN3 OS=Rattus norvegicus GN=Pdzrn3 PE=1 SV=1 50 101 2.0E-06
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 47 89 2.0E-06
sp|Q75EN0|RAD18_ASHGO Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD18 PE=3 SV=1 50 95 2.0E-06
sp|O70263|LNX1_MOUSE E3 ubiquitin-protein ligase LNX OS=Mus musculus GN=Lnx1 PE=1 SV=1 51 96 2.0E-06
sp|Q96EX2|RNFT2_HUMAN RING finger and transmembrane domain-containing protein 2 OS=Homo sapiens GN=RNFT2 PE=2 SV=2 51 93 3.0E-06
sp|Q9DCN7|RNFT1_MOUSE RING finger and transmembrane domain-containing protein 1 OS=Mus musculus GN=Rnft1 PE=2 SV=1 51 89 3.0E-06
sp|Q5R4I2|RNF8_PONAB E3 ubiquitin-protein ligase RNF8 OS=Pongo abelii GN=RNF8 PE=2 SV=1 36 91 3.0E-06
sp|Q2HJ46|RNF8_BOVIN E3 ubiquitin-protein ligase RNF8 OS=Bos taurus GN=RNF8 PE=2 SV=1 36 91 3.0E-06
sp|Q8TBB1|LNX1_HUMAN E3 ubiquitin-protein ligase LNX OS=Homo sapiens GN=LNX1 PE=1 SV=1 51 96 3.0E-06
sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 51 100 3.0E-06
sp|Q7ZX20|RNF8A_XENLA E3 ubiquitin-protein ligase RNF8-A OS=Xenopus laevis GN=rnf8-a PE=2 SV=1 50 95 4.0E-06
sp|Q8N448|LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens GN=LNX2 PE=1 SV=1 51 90 4.0E-06
sp|O76064|RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens GN=RNF8 PE=1 SV=1 36 91 4.0E-06
sp|Q80Z37|TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus GN=Topors PE=1 SV=1 5 90 6.0E-06
sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 51 99 6.0E-06
sp|Q6NRG0|RNF8B_XENLA E3 ubiquitin-protein ligase RNF8-B OS=Xenopus laevis GN=rnf8-b PE=2 SV=1 50 95 6.0E-06
sp|O77666|TRI26_PIG Tripartite motif-containing protein 26 OS=Sus scrofa GN=TRIM26 PE=3 SV=2 51 100 6.0E-06
sp|Q61510|TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus GN=Trim25 PE=1 SV=2 47 95 8.0E-06
sp|Q9V8P9|TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster GN=Topors PE=1 SV=1 8 90 8.0E-06
sp|P53769|CWC24_YEAST Pre-mRNA-splicing factor CWC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC24 PE=1 SV=1 50 92 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4768
LLLTELGARGPQASRVDIAAATHTPVAAAPRFDLARDETMAYIKGRQQRKCTLCLEELRDPSATQCGHVFCWDCI
GDWVREKPECPLCRREAMVQHILPLRVV*
Coding >Hirsu2|4768
CTGCTGCTGACCGAGCTCGGGGCCCGCGGCCCCCAGGCCAGCCGGGTCGACATCGCCGCCGCCACGCACACGCCC
GTCGCCGCCGCGCCCCGCTTCGACCTCGCCCGCGACGAGACCATGGCCTATATCAAGGGCCGCCAGCAGCGCAAG
TGCACCCTGTGTCTCGAAGAGCTCCGCGACCCGTCCGCCACCCAGTGTGGCCACGTCTTCTGCTGGGACTGCATC
GGTGACTGGGTCCGCGAGAAGCCCGAGTGCCCCCTGTGCCGTCGCGAGGCCATGGTGCAGCACATCCTCCCGTTG
CGCGTCGTCTGA
Transcript >Hirsu2|4768
CTGCTGCTGACCGAGCTCGGGGCCCGCGGCCCCCAGGCCAGCCGGGTCGACATCGCCGCCGCCACGCACACGCCC
GTCGCCGCCGCGCCCCGCTTCGACCTCGCCCGCGACGAGACCATGGCCTATATCAAGGGCCGCCAGCAGCGCAAG
TGCACCCTGTGTCTCGAAGAGCTCCGCGACCCGTCCGCCACCCAGTGTGGCCACGTCTTCTGCTGGGACTGCATC
GGTGACTGGGTCCGCGAGAAGCCCGAGTGCCCCCTGTGCCGTCGCGAGGCCATGGTGCAGCACATCCTCCCGTTG
CGCGTCGTCTGA
Gene >Hirsu2|4768
CTGCTGCTGACCGAGCTCGGGGCCCGCGGCCCCCAGGCCAGCCGGGTCGACATCGCCGCCGCCACGCACACGCCC
GTCGCCGCCGCGCCCCGCTTCGACCTCGCCCGCGACGAGACCATGGCCTATATCAAGGGCCGCCAGCAGCGCAAG
TGCACCCTGTGTCTCGAAGAGCTCCGCGACCCGTCCGCCACCCAGTGTGGCCACGTCTTCTGCTGGGACTGCATC
GGTGACTGGGTCCGCGAGAAGCCCGAGTGCCCCCTGTGCCGTCGCGAGGCCATGGTGCAGCACATCCTCCCGTTG
CGCGTCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail