Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4764
Gene name
LocationContig_2401:1621..2602
Strand-
Gene length (bp)981
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 8.4E-16 8 95
PF00153 Mito_carr Mitochondrial carrier protein 9.4E-13 101 179
PF00153 Mito_carr Mitochondrial carrier protein 3.9E-10 197 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZS0|PNC2_ARATH Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana GN=PNC2 PE=1 SV=1 1 316 1.0E-32
sp|Q9MA90|PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 7 301 8.0E-31
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 14 226 1.0E-23
sp|Q75A82|ANT1_ASHGO Peroxisomal adenine nucleotide transporter 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ANT1 PE=3 SV=1 12 320 1.0E-23
sp|B6ZJZ9|PNC1_SOYBN Peroxisomal adenine nucleotide carrier 1 OS=Glycine max GN=PNC1 PE=2 SV=1 4 301 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZS0|PNC2_ARATH Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana GN=PNC2 PE=1 SV=1 1 316 1.0E-32
sp|Q9MA90|PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 7 301 8.0E-31
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 14 226 1.0E-23
sp|Q75A82|ANT1_ASHGO Peroxisomal adenine nucleotide transporter 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ANT1 PE=3 SV=1 12 320 1.0E-23
sp|B6ZJZ9|PNC1_SOYBN Peroxisomal adenine nucleotide carrier 1 OS=Glycine max GN=PNC1 PE=2 SV=1 4 301 4.0E-22
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 10 314 3.0E-21
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 10 300 2.0E-20
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 28 301 8.0E-19
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 6 316 7.0E-18
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 10 300 1.0E-17
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 14 225 7.0E-16
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 14 225 8.0E-16
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 14 225 1.0E-15
sp|Q00319|PM47B_CANBO Peroxisomal membrane protein PMP47B OS=Candida boidinii GN=PMP47B PE=2 SV=1 10 293 2.0E-15
sp|P21245|PM47A_CANBO Peroxisomal membrane protein PMP47A OS=Candida boidinii GN=PMP47A PE=1 SV=1 10 239 1.0E-14
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 16 229 7.0E-13
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 16 226 1.0E-11
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 12 300 2.0E-11
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 13 271 2.0E-11
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 14 289 2.0E-11
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 4 164 4.0E-11
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 17 224 1.0E-10
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 14 226 2.0E-10
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 3 289 2.0E-10
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 16 299 4.0E-10
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 14 255 5.0E-10
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 27 288 7.0E-10
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 12 226 8.0E-10
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 16 314 1.0E-09
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 16 187 1.0E-09
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 15 312 1.0E-09
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 1 223 3.0E-09
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 1 232 3.0E-09
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 14 191 3.0E-09
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 13 235 4.0E-09
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 12 238 4.0E-09
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 16 313 6.0E-09
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 1 232 9.0E-09
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 14 232 9.0E-09
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 17 224 1.0E-08
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 16 314 1.0E-08
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 14 290 1.0E-08
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 1 223 1.0E-08
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 14 290 1.0E-08
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 14 240 2.0E-08
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 9 145 2.0E-08
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 10 135 2.0E-08
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 15 234 2.0E-08
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 18 159 2.0E-08
sp|Q26365|ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 15 290 2.0E-08
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 6 176 3.0E-08
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 14 232 3.0E-08
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 1 223 4.0E-08
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 16 314 4.0E-08
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 16 314 4.0E-08
sp|Q26365|ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 11 138 5.0E-08
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 16 226 5.0E-08
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 3 223 5.0E-08
sp|P0CH61|Y2148_TRIVH Putative mitochondrial carrier protein TRV_02148.2 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02148.2 PE=3 SV=1 17 180 6.0E-08
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 14 290 7.0E-08
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 29 307 9.0E-08
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 14 234 9.0E-08
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 17 224 9.0E-08
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 4 290 9.0E-08
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 27 176 1.0E-07
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 2 180 1.0E-07
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 14 240 1.0E-07
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 14 240 1.0E-07
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 3 160 1.0E-07
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 2 180 2.0E-07
sp|Q27238|ADT1_ANOGA ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 10 135 2.0E-07
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 4 290 2.0E-07
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 1 223 2.0E-07
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 17 254 2.0E-07
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 2 164 2.0E-07
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 14 290 2.0E-07
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 11 235 2.0E-07
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 3 223 2.0E-07
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 4 290 2.0E-07
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 14 234 2.0E-07
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 17 206 2.0E-07
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 17 206 3.0E-07
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 15 311 3.0E-07
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 14 298 3.0E-07
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 14 234 3.0E-07
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 4 165 4.0E-07
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 4 290 4.0E-07
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 14 298 4.0E-07
sp|O97470|ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 4 135 4.0E-07
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 28 224 5.0E-07
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 3 223 5.0E-07
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 14 234 5.0E-07
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 10 135 6.0E-07
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 14 165 6.0E-07
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 14 164 6.0E-07
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 2 184 7.0E-07
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 14 167 7.0E-07
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 10 135 8.0E-07
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 10 135 8.0E-07
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 2 180 8.0E-07
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 2 180 9.0E-07
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 2 174 9.0E-07
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 7 234 9.0E-07
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 10 225 1.0E-06
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 12 225 1.0E-06
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 10 225 1.0E-06
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 1 223 1.0E-06
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 6 225 1.0E-06
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 17 206 1.0E-06
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 27 233 1.0E-06
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 10 135 2.0E-06
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 16 226 2.0E-06
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 1 223 2.0E-06
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 14 184 2.0E-06
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 2 180 2.0E-06
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 12 225 2.0E-06
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 29 289 2.0E-06
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 29 224 2.0E-06
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 14 226 3.0E-06
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 6 184 3.0E-06
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 14 298 3.0E-06
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 12 238 3.0E-06
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 7 234 3.0E-06
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 2 184 3.0E-06
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 11 138 4.0E-06
sp|Q27238|ADT1_ANOGA ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 14 234 4.0E-06
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 14 163 4.0E-06
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 14 298 4.0E-06
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 11 138 5.0E-06
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 21 180 5.0E-06
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 14 225 6.0E-06
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 5 194 6.0E-06
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 14 183 7.0E-06
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 1 184 8.0E-06
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 14 165 8.0E-06
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 14 163 8.0E-06
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 11 138 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 72 94 22
3 153 175 22
4 195 217 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4764
MSPNATLAVLGHAISGSAGTAVSTAAVFPLDLATTRLKAQRMLRGAEHYDGVLDALRAIIKLEGGLSALYNGLGA
DVAKSLIDSFLFFGFYSYLRSRNRQPSIAQELATGAFAGACTKALTTPISTVVTRMQMSSQPKILREALSDVRND
MGIVGLWSGYSATLFLTLNPSITFFVNRRLAKGILPVLEEEDFPVAWVAFLLAAFSKATATAVTYPFQAGKLRLQ
MPRESADEEQLETDDRPQLLGRRASFWSLLCEMLDKTVIGVILKIVRSGGRRALYDGLQGELLKGFLSHGLTMLM
KGFFYRLAIRLWFIKRDQRRHGIEAM*
Coding >Hirsu2|4764
ATGTCTCCCAACGCTACCCTTGCCGTCCTAGGACATGCCATCTCCGGATCTGCGGGTACTGCCGTTTCAACGGCA
GCCGTCTTTCCTCTCGATCTTGCGACGACGCGGCTTAAAGCGCAGCGCATGCTTCGCGGCGCAGAGCACTATGAC
GGGGTGTTAGACGCGCTCAGGGCTATCATCAAACTGGAAGGTGGGCTGTCGGCGCTATACAATGGTCTCGGGGCG
GACGTTGCCAAATCCCTTATAGACAGCTTCCTTTTCTTCGGCTTCTATAGCTACTTGCGCAGCCGCAACCGCCAA
CCAAGTATTGCGCAGGAGCTTGCCACAGGCGCTTTTGCGGGGGCCTGCACAAAAGCCCTAACCACGCCAATTTCG
ACAGTCGTCACGCGAATGCAAATGTCGTCCCAGCCGAAGATCTTGCGGGAAGCACTAAGTGATGTTCGAAACGAC
ATGGGCATAGTTGGACTCTGGTCCGGCTACTCTGCCACCCTTTTTTTGACCCTGAATCCCAGCATCACTTTCTTT
GTTAACCGCAGACTGGCAAAAGGTATTCTCCCCGTCCTAGAAGAAGAAGATTTTCCCGTGGCGTGGGTTGCCTTC
CTGCTAGCCGCCTTCAGTAAGGCCACGGCAACCGCGGTGACCTACCCTTTTCAGGCGGGGAAATTGCGACTCCAA
ATGCCCCGCGAATCAGCCGACGAGGAACAGCTGGAGACGGACGACAGGCCTCAGTTGCTAGGGCGGAGAGCCTCT
TTTTGGTCACTGCTCTGTGAGATGCTTGACAAAACGGTCATCGGAGTAATACTCAAAATCGTCAGGAGCGGAGGT
CGCCGTGCGCTTTATGATGGCCTGCAGGGTGAGCTGCTCAAGGGCTTTTTGAGTCACGGGTTAACTATGCTCATG
AAGGGCTTTTTTTATCGTCTCGCTATTCGTCTTTGGTTTATAAAGCGAGATCAGCGACGCCACGGTATAGAGGCC
ATGTGA
Transcript >Hirsu2|4764
ATGTCTCCCAACGCTACCCTTGCCGTCCTAGGACATGCCATCTCCGGATCTGCGGGTACTGCCGTTTCAACGGCA
GCCGTCTTTCCTCTCGATCTTGCGACGACGCGGCTTAAAGCGCAGCGCATGCTTCGCGGCGCAGAGCACTATGAC
GGGGTGTTAGACGCGCTCAGGGCTATCATCAAACTGGAAGGTGGGCTGTCGGCGCTATACAATGGTCTCGGGGCG
GACGTTGCCAAATCCCTTATAGACAGCTTCCTTTTCTTCGGCTTCTATAGCTACTTGCGCAGCCGCAACCGCCAA
CCAAGTATTGCGCAGGAGCTTGCCACAGGCGCTTTTGCGGGGGCCTGCACAAAAGCCCTAACCACGCCAATTTCG
ACAGTCGTCACGCGAATGCAAATGTCGTCCCAGCCGAAGATCTTGCGGGAAGCACTAAGTGATGTTCGAAACGAC
ATGGGCATAGTTGGACTCTGGTCCGGCTACTCTGCCACCCTTTTTTTGACCCTGAATCCCAGCATCACTTTCTTT
GTTAACCGCAGACTGGCAAAAGGTATTCTCCCCGTCCTAGAAGAAGAAGATTTTCCCGTGGCGTGGGTTGCCTTC
CTGCTAGCCGCCTTCAGTAAGGCCACGGCAACCGCGGTGACCTACCCTTTTCAGGCGGGGAAATTGCGACTCCAA
ATGCCCCGCGAATCAGCCGACGAGGAACAGCTGGAGACGGACGACAGGCCTCAGTTGCTAGGGCGGAGAGCCTCT
TTTTGGTCACTGCTCTGTGAGATGCTTGACAAAACGGTCATCGGAGTAATACTCAAAATCGTCAGGAGCGGAGGT
CGCCGTGCGCTTTATGATGGCCTGCAGGGTGAGCTGCTCAAGGGCTTTTTGAGTCACGGGTTAACTATGCTCATG
AAGGGCTTTTTTTATCGTCTCGCTATTCGTCTTTGGTTTATAAAGCGAGATCAGCGACGCCACGGTATAGAGGCC
ATGTGA
Gene >Hirsu2|4764
ATGTCTCCCAACGCTACCCTTGCCGTCCTAGGACATGCCATCTCCGGATCTGCGGGTACTGCCGTTTCAACGGCA
GCCGTCTTTCCTCTCGATCTTGCGACGACGCGGCTTAAAGCGCAGCGCATGCTTCGCGGCGCAGAGCACTATGAC
GGGGTGTTAGACGCGCTCAGGGCTATCATCAAACTGGAAGGTGGGCTGTCGGCGCTATACAATGGTCTCGGGGCG
GACGTTGCCAAATCCCTTATAGACAGCTTCCTTTTCTTCGGCTTCTATAGCTACTTGCGCAGCCGCAACCGCCAA
CCAAGTATTGCGCAGGAGCTTGCCACAGGCGCTTTTGCGGGGGCCTGCACAAAAGCCCTAACCACGCCAATTTCG
ACAGTCGTCACGCGAATGCAAATGTCGTCCCAGCCGAAGATCTTGCGGGAAGCACTAAGTGATGTTCGAAACGAC
ATGGGCATAGTTGGACTCTGGTCCGGCTACTCTGCCACCCTTTTTTTGACCCTGAATCCCAGCATCACTTTCTTT
GTTAACCGCAGACTGGCAAAAGGTATTCTCCCCGTCCTAGAAGAAGAAGATTTTCCCGTGGCGTGGGTTGCCTTC
CTGCTAGCCGCCTTCAGTAAGGCCACGGCAACCGCGGTGACCTACCCTTTTCAGGCGGGGAAATTGCGACTCCAA
ATGCCCCGCGAATCAGCCGACGAGGAACAGCTGGAGACGGACGACAGGCCTCAGTTGCTAGGGCGGAGAGCCTCT
TTTTGGTCACTGCTCTGTGAGATGCTTGACAAAACGGTCATCGGAGTAATACTCAAAATCGTCAGGAGCGGAGGT
CGCCGTGCGCTTTATGATGGCCTGCAGGGTGAGCTGCTCAAGGGCTTTTTGAGTCACGGGTTAACTATGCTCATG
AAGGGCTTTTTTTATCGTCTCGCTATTCGTCTTTGGTTTATAAAGCGAGATCAGCGACGCCACGGTATAGAGGCC
ATGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail