Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4763
Gene name
LocationContig_2401:282..1484
Strand+
Gene length (bp)1202
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15906 zf-NOSIP Zinc-finger of nitric oxide synthase-interacting protein 6.2E-08 3 75
PF13445 zf-RING_UBOX RING-type zinc-finger 2.1E-06 249 288
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-04 249 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P829|NOSIP_XENTR Nitric oxide synthase-interacting protein OS=Xenopus tropicalis GN=nosip PE=2 SV=1 3 345 3.0E-21
sp|Q3SWY5|NOSIP_BOVIN Nitric oxide synthase-interacting protein OS=Bos taurus GN=NOSIP PE=2 SV=1 3 335 3.0E-20
sp|Q9Y314|NOSIP_HUMAN Nitric oxide synthase-interacting protein OS=Homo sapiens GN=NOSIP PE=1 SV=1 3 335 6.0E-20
sp|Q4R7H4|NOSIP_MACFA Nitric oxide synthase-interacting protein OS=Macaca fascicularis GN=NOSIP PE=2 SV=1 3 335 2.0E-19
sp|Q6NUH3|NOSIP_XENLA Nitric oxide synthase-interacting protein OS=Xenopus laevis GN=nosip PE=2 SV=1 3 345 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P829|NOSIP_XENTR Nitric oxide synthase-interacting protein OS=Xenopus tropicalis GN=nosip PE=2 SV=1 3 345 3.0E-21
sp|Q3SWY5|NOSIP_BOVIN Nitric oxide synthase-interacting protein OS=Bos taurus GN=NOSIP PE=2 SV=1 3 335 3.0E-20
sp|Q9Y314|NOSIP_HUMAN Nitric oxide synthase-interacting protein OS=Homo sapiens GN=NOSIP PE=1 SV=1 3 335 6.0E-20
sp|Q4R7H4|NOSIP_MACFA Nitric oxide synthase-interacting protein OS=Macaca fascicularis GN=NOSIP PE=2 SV=1 3 335 2.0E-19
sp|Q6NUH3|NOSIP_XENLA Nitric oxide synthase-interacting protein OS=Xenopus laevis GN=nosip PE=2 SV=1 3 345 6.0E-19
sp|Q9D6T0|NOSIP_MOUSE Nitric oxide synthase-interacting protein OS=Mus musculus GN=Nosip PE=1 SV=1 3 335 3.0E-18
sp|Q55DU4|NOSIP_DICDI Nitric oxide synthase-interacting protein homolog OS=Dictyostelium discoideum GN=nosip PE=2 SV=1 3 305 8.0E-18
sp|Q5U3S7|NOSIP_DANRE Nitric oxide synthase-interacting protein OS=Danio rerio GN=nosip PE=2 SV=1 3 345 5.0E-16
sp|Q21755|NOSIP_CAEEL Nitric oxide synthase-interacting protein homolog OS=Caenorhabditis elegans GN=R05G6.4 PE=3 SV=1 3 260 1.0E-14
sp|Q9VWV8|NOSIP_DROME Nitric oxide synthase-interacting protein homolog OS=Drosophila melanogaster GN=CG6179 PE=3 SV=1 3 285 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4763
MSHSKRNTSRPVFTSHERALAKSNWSTTSARLNRDSFLPFGSCALCLGIAREPVACSQGDVFCRECALTNILAQK
REIKRLEKARRDARDEAKTISAVVDEEDRERAIRDFEMTQAGLLPSNANHPVDRQAGTSTNEPLKEGTIARLKRK
FTLDEKELDQIAKNDRNRARKAIEKEKNKKPTLPCFWAPSLTPEVQDNTPPLSSQKDKLVPTCPCSLDGDPHSIS
MQKLVAIHFKEEDGSKNETKRLICPSCLKTLSNSSNPVMAEQCGHVFCMPCIKLLAKSTLDFVTSAKTPTTCFVC
DTPLAPITFWDLAGALLSPGLVTLRSEGTGFSARGSNTVIKASTAFQC*
Coding >Hirsu2|4763
ATGTCCCATAGCAAACGAAACACGTCGCGTCCCGTGTTTACGTCCCACGAGAGGGCTTTGGCAAAGTCCAACTGG
AGTACCACCTCCGCGCGCCTGAACCGTGATTCCTTTCTACCATTCGGTTCCTGCGCCTTGTGTCTTGGCATCGCG
AGAGAGCCGGTCGCGTGCTCGCAAGGCGACGTATTCTGTCGCGAGTGTGCGCTTACCAACATCTTGGCTCAGAAA
AGAGAGATCAAACGATTGGAAAAAGCTCGTCGCGACGCGAGAGATGAAGCCAAAACTATAAGTGCTGTTGTGGAT
GAAGAGGATCGCGAGAGGGCCATTCGCGACTTTGAGATGACACAAGCCGGTCTACTTCCTTCCAACGCCAACCAT
CCCGTTGACCGGCAGGCCGGGACTTCAACGAATGAACCGCTAAAAGAAGGAACCATCGCTAGATTGAAGCGGAAA
TTCACTTTAGACGAAAAAGAACTTGACCAAATAGCGAAGAATGATCGGAACAGAGCGAGGAAGGCTATTGAAAAG
GAAAAGAACAAGAAACCGACGCTTCCATGCTTTTGGGCTCCGTCACTTACCCCGGAAGTTCAAGACAATACACCG
CCGCTCTCCTCTCAGAAGGACAAGTTGGTGCCCACCTGTCCTTGTTCGCTCGACGGCGACCCGCACTCGATTTCG
ATGCAGAAGCTGGTTGCCATTCACTTCAAAGAGGAAGATGGTTCTAAGAACGAAACGAAACGGCTGATTTGTCCT
TCATGCCTCAAGACTCTGTCGAACTCGTCAAACCCCGTCATGGCAGAGCAATGCGGCCATGTCTTCTGTATGCCC
TGTATCAAGTTGCTGGCCAAATCTACGCTGGATTTTGTGACGTCAGCAAAGACGCCCACGACTTGCTTTGTCTGT
GATACGCCATTGGCGCCCATTACTTTCTGGGATTTGGCAGGTGCCTTGTTGTCTCCTGGTCTCGTGACTTTAAGA
TCAGAAGGGACAGGATTCTCAGCGCGAGGTTCGAACACAGTTATTAAAGCGAGCACAGCCTTTCAGTGTTGA
Transcript >Hirsu2|4763
ATGTCCCATAGCAAACGAAACACGTCGCGTCCCGTGTTTACGTCCCACGAGAGGGCTTTGGCAAAGTCCAACTGG
AGTACCACCTCCGCGCGCCTGAACCGTGATTCCTTTCTACCATTCGGTTCCTGCGCCTTGTGTCTTGGCATCGCG
AGAGAGCCGGTCGCGTGCTCGCAAGGCGACGTATTCTGTCGCGAGTGTGCGCTTACCAACATCTTGGCTCAGAAA
AGAGAGATCAAACGATTGGAAAAAGCTCGTCGCGACGCGAGAGATGAAGCCAAAACTATAAGTGCTGTTGTGGAT
GAAGAGGATCGCGAGAGGGCCATTCGCGACTTTGAGATGACACAAGCCGGTCTACTTCCTTCCAACGCCAACCAT
CCCGTTGACCGGCAGGCCGGGACTTCAACGAATGAACCGCTAAAAGAAGGAACCATCGCTAGATTGAAGCGGAAA
TTCACTTTAGACGAAAAAGAACTTGACCAAATAGCGAAGAATGATCGGAACAGAGCGAGGAAGGCTATTGAAAAG
GAAAAGAACAAGAAACCGACGCTTCCATGCTTTTGGGCTCCGTCACTTACCCCGGAAGTTCAAGACAATACACCG
CCGCTCTCCTCTCAGAAGGACAAGTTGGTGCCCACCTGTCCTTGTTCGCTCGACGGCGACCCGCACTCGATTTCG
ATGCAGAAGCTGGTTGCCATTCACTTCAAAGAGGAAGATGGTTCTAAGAACGAAACGAAACGGCTGATTTGTCCT
TCATGCCTCAAGACTCTGTCGAACTCGTCAAACCCCGTCATGGCAGAGCAATGCGGCCATGTCTTCTGTATGCCC
TGTATCAAGTTGCTGGCCAAATCTACGCTGGATTTTGTGACGTCAGCAAAGACGCCCACGACTTGCTTTGTCTGT
GATACGCCATTGGCGCCCATTACTTTCTGGGATTTGGCAGGTGCCTTGTTGTCTCCTGGTCTCGTGACTTTAAGA
TCAGAAGGGACAGGATTCTCAGCGCGAGGTTCGAACACAGTTATTAAAGCGAGCACAGCCTTTCAGTGTTGA
Gene >Hirsu2|4763
ATGTCCCATAGTAAGTCAGGATCCGCCCCATATTGGTTTTTCAAACTTCTTCCTAACTGCTATACGAAACCTCCC
CCGGAAGGCAAACGAAACACGTCGCGTCCCGTGTTTACGTCCCACGAGAGGGCTTTGGCAAAGTCCAACTGGAGT
ACCACCTCCGCGCGCCTGAACCGTGATTCCTTTCTACCATTCGGTTCCTGCGCCTTGTGTCTTGGCATCGCGAGA
GAGCCGGTCGCGTGCTCGCAAGGCGACGTATTCTGTCGCGAGTGTGCGCTTACCAACATCTTGGCTCAGAAAAGA
GAGATCAAACGATTGGAAAAAGCTCGTCGCGACGCGAGAGATGAAGCCAAAACTATAAGTGCTGTTGTGGATGAA
GAGGATCGCGAGAGGGCCATTCGCGACTTTGAGATGACACAAGCCGGTCTACTTCCTTCCAACGCCAACCATCCC
GTTGACCGGCAGGCCGGGACTTCAACGAATGAACCGCTAAAAGAAGGAACCATCGCTAGATTGAAGCGGAAATTC
ACTTTAGACGAAAAAGAACTTGACCAAATAGCGAAGAATGATCGGAACAGAGCGAGGAAGGCTATTGAAAAGGAA
AAGGTTGGTAATTTGTCTCTCGCCCTTTGCCCAAAGTATTCACTCTGCCAAACTCGATCGTGATTTCTGATCACC
GCGCGACGCAGAACAAGAAACCGACGCTTCCATGCTTTTGGGCTCCGTCACTTACCCCGGAAGTTCAAGACAATA
CACCGCCGCTCTCCTCTCAGAAGGACAAGTTGGTGCCCACCTGTCCTTGTTCGCTCGACGGCGACCCGCACTCGA
TTTCGATGCAGAAGCTGGTTGCCATTCACTTCAAAGAGGAAGATGGTTCTAAGAACGAAACGAAACGGCTGATTT
GTCCTTCATGCCTCAAGACTCTGTCGAACTCGTCAAACCCCGTCATGGCAGAGCAATGCGGCCATGTCTTCTGTA
TGCCCTGTATCAAGTTGCTGGCCAAATCTACGCTGGATTTTGTGACGTCAGCAAAGACGCCCACGACTTGCTTTG
TCTGTGATACGCCATTGGCGCCCATTACTTTCTGGGATTTGGCAGGTGCCTTGTTGTCTCCTGGTCTCGTGACTT
TAAGATCAGAAGGGACAGGATTCTCAGCGCGAGGTTCGAACACAGTTATTAAAGCGAGCACAGCCTTTCAGTGTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail