Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4754
Gene name
LocationContig_240:3848..5175
Strand+
Gene length (bp)1327
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07264 EI24 Etoposide-induced protein 2.4 (EI24) 2.2E-12 50 263

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08219|RRT8_YEAST Outer spore wall protein RRT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT8 PE=1 SV=2 41 278 1.0E-15
sp|P31379|LDS1_YEAST Outer spore wall protein LDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDS1 PE=1 SV=1 41 290 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 94 116 22
3 188 210 22
4 243 265 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4754
MPDSSPAGGQSRRGRVVDALGDKAQQVLAEDYGRARTVAFDALRSRAYLYPFKGIAYFATHRSLWRPLLSRLGPY
LGLSASVVGGMFAFTYLPQLAVLVLVNGPLAVASTVLLVLSESAAVVNVLARGWILQDAVLDTFDGTLLARGATG
AVSEGRELRPGGGEPMQRLGRILKSPFDRLGPKALIRYFIYLPLNFIPVVGTAIFIFLQGRNRGHVVHDRYFQLK
KWSKSQRASWLEKHTGPYTSFGLIATVLEMIPLASLFFTFTNTVGAALWAADIEALQTSMTDDTAPSLRETAKKV
E*
Coding >Hirsu2|4754
ATGCCCGACTCCAGCCCAGCCGGCGGCCAGTCGAGGCGCGGGCGCGTCGTCGACGCTCTTGGCGACAAGGCGCAG
CAGGTCCTGGCGGAGGACTACGGCCGGGCGAGGACGGTCGCCTTCGATGCGCTCCGGAGCAGGGCCTACCTGTAT
CCCTTCAAGGGCATCGCCTACTTCGCGACGCACCGCTCGCTCTGGCGGCCGCTGCTGTCGCGGCTGGGGCCGTAC
CTCGGCCTGTCGGCCAGCGTGGTGGGCGGCATGTTCGCCTTCACCTACCTGCCGCAGCTGGCGGTGCTGGTGCTG
GTCAACGGGCCGCTGGCGGTGGCGAGCACGGTGCTGCTGGTGCTCAGCGAGAGCGCGGCCGTGGTCAACGTGCTG
GCGCGCGGCTGGATCTTGCAAGACGCCGTGCTCGACACCTTCGACGGCACGCTGCTGGCGCGCGGCGCCACTGGT
GCCGTGAGCGAGGGCCGCGAGCTGCGCCCCGGCGGCGGCGAGCCCATGCAGCGCCTCGGCCGCATCCTCAAGAGC
CCCTTTGACCGCCTCGGGCCCAAGGCCCTGATCCGCTACTTCATCTACCTGCCGCTCAACTTCATCCCCGTCGTC
GGCACCGCCATCTTCATCTTTCTGCAAGGGCGTAACCGTGGCCACGTGGTTCACGATCGGTACTTCCAGCTGAAG
AAGTGGTCCAAGTCTCAGCGAGCGAGTTGGCTGGAAAAGCACACCGGCCCTTACACGTCCTTTGGCCTCATCGCA
ACTGTGCTCGAGATGATACCGCTGGCTTCGCTATTCTTTACCTTTACCAACACCGTCGGCGCGGCGCTCTGGGCA
GCCGACATTGAGGCGCTCCAAACATCCATGACGGACGACACTGCTCCTTCGCTGCGGGAGACAGCAAAGAAGGTC
GAGTAA
Transcript >Hirsu2|4754
ATGCCCGACTCCAGCCCAGCCGGCGGCCAGTCGAGGCGCGGGCGCGTCGTCGACGCTCTTGGCGACAAGGCGCAG
CAGGTCCTGGCGGAGGACTACGGCCGGGCGAGGACGGTCGCCTTCGATGCGCTCCGGAGCAGGGCCTACCTGTAT
CCCTTCAAGGGCATCGCCTACTTCGCGACGCACCGCTCGCTCTGGCGGCCGCTGCTGTCGCGGCTGGGGCCGTAC
CTCGGCCTGTCGGCCAGCGTGGTGGGCGGCATGTTCGCCTTCACCTACCTGCCGCAGCTGGCGGTGCTGGTGCTG
GTCAACGGGCCGCTGGCGGTGGCGAGCACGGTGCTGCTGGTGCTCAGCGAGAGCGCGGCCGTGGTCAACGTGCTG
GCGCGCGGCTGGATCTTGCAAGACGCCGTGCTCGACACCTTCGACGGCACGCTGCTGGCGCGCGGCGCCACTGGT
GCCGTGAGCGAGGGCCGCGAGCTGCGCCCCGGCGGCGGCGAGCCCATGCAGCGCCTCGGCCGCATCCTCAAGAGC
CCCTTTGACCGCCTCGGGCCCAAGGCCCTGATCCGCTACTTCATCTACCTGCCGCTCAACTTCATCCCCGTCGTC
GGCACCGCCATCTTCATCTTTCTGCAAGGGCGTAACCGTGGCCACGTGGTTCACGATCGGTACTTCCAGCTGAAG
AAGTGGTCCAAGTCTCAGCGAGCGAGTTGGCTGGAAAAGCACACCGGCCCTTACACGTCCTTTGGCCTCATCGCA
ACTGTGCTCGAGATGATACCGCTGGCTTCGCTATTCTTTACCTTTACCAACACCGTCGGCGCGGCGCTCTGGGCA
GCCGACATTGAGGCGCTCCAAACATCCATGACGGACGACACTGCTCCTTCGCTGCGGGAGACAGCAAAGAAGGTC
GAGTAA
Gene >Hirsu2|4754
ATGCCCGACTCCAGCCCAGCCGGCGGCCAGTCGAGGCGCGGGCGCGTCGTCGACGCTCTTGGCGACAAGGCGCAG
CAGGTCCTGTGCGTGTCCTTCTCTCCCCGATCGTCCCGTCGATTTCCCTCGGGTCGCTCGTTTGCGCCTTCGTGC
GAGGGCAATTGCTGATGGCGTGCCGGCAGGGCGGAGGACTACGGCCGGGCGAGGACGGTCGCCTTCGATGCGCTC
CGGAGCAGGGCCTACCTGTATCCCTTCAAGGTGAGAGAGAAGGGCCGTGTGTTCGCGTCGGGTAGAGCGCTGACA
TCCTCCGCAGGGCATCGCCTACTTCGCGACGCACCGCTCGCTCTGGCGGCCGCTGCTGTCGCGGCTGGGGCCGTA
CCTCGGCCTGTCGGCCAGCGTGGTGGGCGGCATGTTCGCCTTCACCTACCTGCCGCAGCTGGCGGTGCTGGTGCT
GGTCAACGGGCCGCTGGCGGTGGCGAGCACGGTGCTGCTGGTGCTCAGCGAGAGCGCGGCCGTGGTCAACGTGCT
GGCGCGCGGCTGGATCTTGCAAGACGCCGTGCTCGACACCTTCGACGGCACGCTGCTGGCGCGCGGCGCCACTGG
TGCCGTGAGCGAGGGCCGCGAGCTGCGCCCCGGCGGCGGCGAGCCCATGCAGCGCCTCGGCCGCATCCTCAAGAG
CCCCTTTGACCGCCTCGGGCCCAAGGCCCTGATCCGCTACTTCATCTACCTGCCGCTCAACTTCATCCCCGTCGT
CGGCACCGCCATCTTCATCTTTCTGCAAGGTTTGTTCTCGTCATCCCCTGCCCTGTCGTGCCGTGTGCTGACGGA
CGGGGGTCCGCCGCCTTGTCTAGGGCGTAACCGTGGCCACGTGGTTCACGATCGGGTGAGAGGTCGTCCGCGTCC
CGACCTTCGAAGCATGAGCTGACGACGGCGGTTGCCGATGCAGTACTTCCAGCTGAAGAAGTGGTCCAAGTCTCA
GCGAGCGAGTTGGCTGGAAAAGCACACCGGCCCTTACACGTCGTGAGTCACGCCCACGGCAGAGGGCGCGGCTTC
CAAGTCGGCCTGATACCAACATCACTGGCCATCCGCTGACGTCGAGTCTCGTAGCTTTGGCCTCATCGCAACTGT
GCTCGAGATGATACCGCTGGCTTCGCTATTCTTTACCTTTACCAACACCGGTGAGAGCCTCTGTACGCCTCCCTT
GATCATAGTTTTGCTAACCGATTCAGTCGGCGCGGCGCTCTGGGCAGCCGACATTGAGGCGCTCCAAACATCCAT
GACGGACGACACTGCTCCTTCGCTGCGGGAGACAGCAAAGAAGGTCGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail