Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4748
Gene name
LocationContig_24:46609..49568
Strand-
Gene length (bp)2959
Transcript length (bp)2901
Coding sequence length (bp)2901
Protein length (aa) 967

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 38 948 8.0E-83
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 314 962 3.0E-44
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 271 676 1.0E-25
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 324 454 2.0E-21
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 324 454 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 38 948 8.0E-83
sp|F4JKK0|SUD1_ARATH Probable E3 ubiquitin ligase SUD1 OS=Arabidopsis thaliana GN=SUD1 PE=1 SV=1 314 962 3.0E-44
sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 271 676 1.0E-25
sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 324 454 2.0E-21
sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 324 454 2.0E-21
sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 324 454 2.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 115 137 22
3 267 285 18
4 317 339 22
5 359 381 22
6 423 445 22
7 655 677 22
8 697 719 22
9 751 773 22
10 854 876 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4748
MADGLDDNVDADMADVDGVVAGAGLDPEAMDDLEDFEGVMELIGMRGPIAGLFQNAIFCAVLVSVTVFACIFIPY
NIGRVSVWVVANPIQLVRMLLEFSKVVQDAVIMFGGLSSWFVLNLLDIFTGLVGGALGGMVVSARKASWGLWTGA
GTRVMEYALMDFPISASEMQNFSAISHEALLSVKGSVASAVGTLDACFASLITAPLRFFDGKLLHTVASAAKSVP
RNLEAALMLVLDPGSWVIDLSGAEVRAPVDPSLAYWPGLDRFWAILAGYLTIFAISAMYLRRGTPFARGNMLQAW
EAGVIDTLHQASGIMKVIVIISIEMLVFPLYCGLLLDAALLPLFEDTTIKSRILFTYNFPLTSVFVHWFVGTGYM
FHFALFVSMCRKIMRPGVLYFIRDPDDPEFHPIRDVLERSLTTQLRKILFSAFVYGALVIVCLGGVVWCLSYSMP
GVLPIHYSSNEPVLEFPVDLLFYNFLMPQAVKVLKPGDGLHTMYTWWFRKCARGLRLTYFLFGERRIDEEGTLQL
RPDSPNRQSRYKSLLLELSEHNEVVPKTWRDTFEGGNAKPNPALSNREEHALRRRKRQLVTSGQLVRSGRFVRAP
ASDRVKIPKGKQVFLHVSELGRRKDGNADNDIYASGQYQMVYIPPNFRLRIFLFILFIWLFAAVTGVGITIAPLA
LGRKMFKVLIPEHIRTNDIYAFSIGIYVLGTASYSVFCMQRILAGVRGWINRAWAEVLRGHAHRHVLSGLARGGK
LVYAYVFLLVVFPLLFSTLMELYITIPLHTYMDPPKAASASAASTAKQAGDAGRHTVRVIQAWTLGLLYLNLGTR
MISSLFPESRPALAVRTVMRRGWLRPDIGILTRAFVIPGLAVATVAMFGPPLMASLLIRLDVFGTQAGAPVAMIY
RHSYPAAALAAALARHAIGMATVFKGWKAGIRDEAYLIGERLHNFGATTAGVRKAKRAWGAGRSRL*
Coding >Hirsu2|4748
ATGGCCGACGGCCTTGACGACAACGTTGACGCAGATATGGCAGACGTCGATGGAGTAGTCGCAGGCGCAGGCTTG
GACCCCGAGGCCATGGACGATCTCGAGGACTTTGAGGGCGTCATGGAGCTTATAGGCATGCGTGGGCCGATCGCA
GGTCTGTTCCAGAACGCCATCTTCTGCGCTGTTCTGGTATCCGTCACCGTCTTCGCCTGCATCTTCATCCCTTAC
AACATTGGCCGCGTCAGTGTGTGGGTCGTGGCCAACCCAATCCAGCTCGTCCGCATGCTCCTGGAGTTCTCCAAA
GTCGTGCAGGATGCTGTCATCATGTTTGGTGGACTGAGCTCCTGGTTCGTCCTGAACCTGCTCGACATTTTCACT
GGCCTCGTTGGTGGAGCATTGGGCGGCATGGTGGTCTCGGCCAGAAAGGCGTCCTGGGGACTGTGGACTGGTGCT
GGAACCAGAGTCATGGAGTACGCCCTGATGGACTTTCCCATTTCTGCCTCGGAGATGCAGAATTTCTCGGCCATC
AGCCATGAAGCCCTGCTTTCCGTCAAGGGATCTGTTGCCTCGGCCGTTGGGACGCTGGATGCCTGCTTTGCCTCC
CTCATCACCGCACCTCTTCGTTTCTTTGATGGCAAGCTTCTGCACACAGTGGCCTCCGCCGCGAAATCGGTTCCG
AGAAATCTGGAGGCAGCCCTGATGCTCGTCCTCGATCCTGGGTCGTGGGTCATCGACCTGAGCGGAGCAGAGGTG
CGCGCACCTGTCGACCCGAGCTTGGCCTACTGGCCCGGTCTCGACCGCTTCTGGGCCATTCTCGCCGGCTACCTC
ACCATCTTCGCCATCAGCGCCATGTACCTGCGCAGGGGCACTCCCTTCGCCAGAGGCAACATGCTGCAGGCGTGG
GAAGCCGGTGTCATCGACACGCTTCACCAGGCGAGTGGCATCATGAAGGTCATTGTCATTATTAGCATCGAGATG
CTGGTCTTCCCACTCTACTGCGGGCTTCTCCTAGACGCCGCTCTCTTGCCTCTGTTTGAGGACACGACCATCAAA
TCTCGCATTCTTTTCACCTACAATTTCCCTCTTACCTCGGTCTTCGTCCATTGGTTCGTCGGGACGGGATACATG
TTCCATTTCGCACTCTTTGTGTCTATGTGCCGGAAGATCATGCGTCCTGGTGTCTTGTACTTCATTCGAGACCCC
GATGACCCCGAGTTTCATCCCATCCGCGACGTGCTCGAGAGAAGCCTTACCACGCAGTTGAGGAAGATATTATTC
TCCGCCTTCGTGTACGGCGCTCTCGTCATCGTCTGCCTTGGCGGTGTCGTCTGGTGCCTGTCGTACAGCATGCCA
GGCGTGCTGCCGATTCACTATTCGTCGAACGAGCCGGTACTCGAGTTCCCGGTCGACCTCCTCTTCTACAACTTC
CTCATGCCGCAAGCCGTCAAGGTGCTCAAGCCAGGCGATGGTCTGCACACCATGTACACTTGGTGGTTCCGCAAA
TGTGCCCGCGGTCTTCGGCTCACGTACTTTCTTTTCGGCGAACGGCGGATCGACGAGGAGGGCACTCTGCAGCTC
CGCCCTGACTCCCCGAATCGCCAATCGCGATATAAGTCGCTCCTTCTGGAACTCAGCGAGCACAACGAGGTCGTT
CCAAAGACGTGGCGGGACACTTTCGAGGGCGGCAATGCCAAGCCGAATCCGGCGCTATCGAACCGGGAAGAGCAT
GCGCTGAGAAGGAGAAAACGGCAGCTGGTGACTTCCGGCCAGCTTGTTCGCAGTGGACGCTTCGTACGAGCGCCT
GCTTCGGACCGCGTCAAGATCCCCAAGGGTAAACAAGTCTTCTTGCACGTCTCAGAGCTCGGGCGGCGCAAAGAC
GGCAATGCGGACAATGACATCTACGCCTCGGGCCAATACCAAATGGTCTACATCCCGCCAAACTTTCGCCTCAGA
ATCTTCTTGTTCATCCTCTTCATTTGGCTTTTCGCGGCGGTGACGGGCGTCGGCATCACGATTGCTCCGCTCGCT
CTGGGGCGGAAAATGTTCAAGGTGCTAATCCCGGAACACATTCGCACCAACGACATTTATGCCTTCAGCATAGGC
ATTTATGTGCTTGGCACCGCAAGCTACTCAGTTTTCTGCATGCAACGCATCCTAGCCGGCGTCCGGGGCTGGATC
AATAGGGCCTGGGCCGAGGTGCTGAGAGGACACGCTCACAGACACGTCTTGTCCGGGCTCGCGCGCGGCGGCAAG
CTCGTGTACGCCTACGTCTTCCTCCTCGTCGTGTTCCCGCTCCTGTTCTCTACGCTCATGGAGCTGTACATCACG
ATACCGTTGCACACATATATGGACCCACCCAAGGCAGCATCAGCATCGGCTGCGTCAACAGCGAAGCAGGCGGGC
GACGCTGGCCGCCATACCGTCCGGGTCATCCAAGCCTGGACTCTGGGCCTCCTCTATTTGAATCTGGGAACCAGA
ATGATCTCGTCCCTCTTCCCTGAAAGCCGGCCAGCTCTGGCTGTGCGTACTGTGATGCGGCGGGGGTGGTTGCGA
CCGGATATTGGCATCCTGACCAGGGCGTTTGTCATTCCCGGGCTGGCGGTAGCGACGGTAGCGATGTTTGGCCCG
CCTCTGATGGCCAGCTTGCTCATCAGGCTCGACGTGTTTGGCACCCAGGCCGGGGCCCCCGTGGCCATGATCTAC
CGACACTCGTATCCCGCGGCAGCGCTAGCGGCAGCACTGGCAAGACACGCGATCGGGATGGCCACAGTCTTCAAG
GGCTGGAAGGCGGGAATACGCGACGAGGCGTATCTGATTGGAGAGCGACTACACAACTTCGGGGCCACCACGGCT
GGGGTTCGCAAGGCAAAGAGAGCGTGGGGAGCAGGACGATCGAGGCTCTGA
Transcript >Hirsu2|4748
ATGGCCGACGGCCTTGACGACAACGTTGACGCAGATATGGCAGACGTCGATGGAGTAGTCGCAGGCGCAGGCTTG
GACCCCGAGGCCATGGACGATCTCGAGGACTTTGAGGGCGTCATGGAGCTTATAGGCATGCGTGGGCCGATCGCA
GGTCTGTTCCAGAACGCCATCTTCTGCGCTGTTCTGGTATCCGTCACCGTCTTCGCCTGCATCTTCATCCCTTAC
AACATTGGCCGCGTCAGTGTGTGGGTCGTGGCCAACCCAATCCAGCTCGTCCGCATGCTCCTGGAGTTCTCCAAA
GTCGTGCAGGATGCTGTCATCATGTTTGGTGGACTGAGCTCCTGGTTCGTCCTGAACCTGCTCGACATTTTCACT
GGCCTCGTTGGTGGAGCATTGGGCGGCATGGTGGTCTCGGCCAGAAAGGCGTCCTGGGGACTGTGGACTGGTGCT
GGAACCAGAGTCATGGAGTACGCCCTGATGGACTTTCCCATTTCTGCCTCGGAGATGCAGAATTTCTCGGCCATC
AGCCATGAAGCCCTGCTTTCCGTCAAGGGATCTGTTGCCTCGGCCGTTGGGACGCTGGATGCCTGCTTTGCCTCC
CTCATCACCGCACCTCTTCGTTTCTTTGATGGCAAGCTTCTGCACACAGTGGCCTCCGCCGCGAAATCGGTTCCG
AGAAATCTGGAGGCAGCCCTGATGCTCGTCCTCGATCCTGGGTCGTGGGTCATCGACCTGAGCGGAGCAGAGGTG
CGCGCACCTGTCGACCCGAGCTTGGCCTACTGGCCCGGTCTCGACCGCTTCTGGGCCATTCTCGCCGGCTACCTC
ACCATCTTCGCCATCAGCGCCATGTACCTGCGCAGGGGCACTCCCTTCGCCAGAGGCAACATGCTGCAGGCGTGG
GAAGCCGGTGTCATCGACACGCTTCACCAGGCGAGTGGCATCATGAAGGTCATTGTCATTATTAGCATCGAGATG
CTGGTCTTCCCACTCTACTGCGGGCTTCTCCTAGACGCCGCTCTCTTGCCTCTGTTTGAGGACACGACCATCAAA
TCTCGCATTCTTTTCACCTACAATTTCCCTCTTACCTCGGTCTTCGTCCATTGGTTCGTCGGGACGGGATACATG
TTCCATTTCGCACTCTTTGTGTCTATGTGCCGGAAGATCATGCGTCCTGGTGTCTTGTACTTCATTCGAGACCCC
GATGACCCCGAGTTTCATCCCATCCGCGACGTGCTCGAGAGAAGCCTTACCACGCAGTTGAGGAAGATATTATTC
TCCGCCTTCGTGTACGGCGCTCTCGTCATCGTCTGCCTTGGCGGTGTCGTCTGGTGCCTGTCGTACAGCATGCCA
GGCGTGCTGCCGATTCACTATTCGTCGAACGAGCCGGTACTCGAGTTCCCGGTCGACCTCCTCTTCTACAACTTC
CTCATGCCGCAAGCCGTCAAGGTGCTCAAGCCAGGCGATGGTCTGCACACCATGTACACTTGGTGGTTCCGCAAA
TGTGCCCGCGGTCTTCGGCTCACGTACTTTCTTTTCGGCGAACGGCGGATCGACGAGGAGGGCACTCTGCAGCTC
CGCCCTGACTCCCCGAATCGCCAATCGCGATATAAGTCGCTCCTTCTGGAACTCAGCGAGCACAACGAGGTCGTT
CCAAAGACGTGGCGGGACACTTTCGAGGGCGGCAATGCCAAGCCGAATCCGGCGCTATCGAACCGGGAAGAGCAT
GCGCTGAGAAGGAGAAAACGGCAGCTGGTGACTTCCGGCCAGCTTGTTCGCAGTGGACGCTTCGTACGAGCGCCT
GCTTCGGACCGCGTCAAGATCCCCAAGGGTAAACAAGTCTTCTTGCACGTCTCAGAGCTCGGGCGGCGCAAAGAC
GGCAATGCGGACAATGACATCTACGCCTCGGGCCAATACCAAATGGTCTACATCCCGCCAAACTTTCGCCTCAGA
ATCTTCTTGTTCATCCTCTTCATTTGGCTTTTCGCGGCGGTGACGGGCGTCGGCATCACGATTGCTCCGCTCGCT
CTGGGGCGGAAAATGTTCAAGGTGCTAATCCCGGAACACATTCGCACCAACGACATTTATGCCTTCAGCATAGGC
ATTTATGTGCTTGGCACCGCAAGCTACTCAGTTTTCTGCATGCAACGCATCCTAGCCGGCGTCCGGGGCTGGATC
AATAGGGCCTGGGCCGAGGTGCTGAGAGGACACGCTCACAGACACGTCTTGTCCGGGCTCGCGCGCGGCGGCAAG
CTCGTGTACGCCTACGTCTTCCTCCTCGTCGTGTTCCCGCTCCTGTTCTCTACGCTCATGGAGCTGTACATCACG
ATACCGTTGCACACATATATGGACCCACCCAAGGCAGCATCAGCATCGGCTGCGTCAACAGCGAAGCAGGCGGGC
GACGCTGGCCGCCATACCGTCCGGGTCATCCAAGCCTGGACTCTGGGCCTCCTCTATTTGAATCTGGGAACCAGA
ATGATCTCGTCCCTCTTCCCTGAAAGCCGGCCAGCTCTGGCTGTGCGTACTGTGATGCGGCGGGGGTGGTTGCGA
CCGGATATTGGCATCCTGACCAGGGCGTTTGTCATTCCCGGGCTGGCGGTAGCGACGGTAGCGATGTTTGGCCCG
CCTCTGATGGCCAGCTTGCTCATCAGGCTCGACGTGTTTGGCACCCAGGCCGGGGCCCCCGTGGCCATGATCTAC
CGACACTCGTATCCCGCGGCAGCGCTAGCGGCAGCACTGGCAAGACACGCGATCGGGATGGCCACAGTCTTCAAG
GGCTGGAAGGCGGGAATACGCGACGAGGCGTATCTGATTGGAGAGCGACTACACAACTTCGGGGCCACCACGGCT
GGGGTTCGCAAGGCAAAGAGAGCGTGGGGAGCAGGACGATCGAGGCTCTGA
Gene >Hirsu2|4748
ATGGCCGACGGCCTTGACGACAACGTTGACGCAGATATGGCAGACGTCGATGGAGTAGTCGCAGGCGCAGGCTTG
GACCCCGAGGCCATGGACGATCTCGAGGACTTTGAGGGCGTCATGGAGCTTATAGGCATGCGTGGGCCGATCGCA
GGTCTGTTCCAGAACGCCATCTTCTGCGCTGTTCTGGTATCCGTCACCGTCTTCGCCTGCATCTTCATCCCTTAC
AACATTGGCCGCGTCAGTGTGTGGGTCGTGGCCAACCCAATCCAGCTCGTCCGCATGCTCCTGGAGTTCTCCAAA
GTCGTGCAGGATGCTGTCATCATGTTTGGTGGACTGAGCTCCTGGTTCGTCCTGAACCTGCTCGACATTTTCACT
GGCCTCGTTGGTGGAGCATTGGGCGGCATGGTGGTCTCGGCCAGAAAGGCGTCCTGGGGACTGTGGACTGGTGCT
GGAACCAGAGTCATGGAGTACGCCCTGATGGACTTTCCCATTTCTGCCTCGGAGATGCAGAATTTCTCGGCCATC
AGCCATGAAGCCCTGCTTTCCGTCAAGGGATCTGTTGCCTCGGCCGTTGGGACGCTGGATGCCTGCTTTGCCTCC
CTCATCACCGCACCTCTTCGTTTCTTTGATGGCAAGCTTCTGCACACAGTGGCCTCCGCCGCGAAATCGGTTCCG
AGAAATCTGGAGGCAGCCCTGATGCTCGTCCTCGATCCTGGGTCGTGGGTCATCGACCTGAGCGGAGCAGAGGTG
CGCGCACCTGTCGACCCGAGCTTGGCCTACTGGCCCGGTCTCGACCGCTTCTGGGCCATTCTCGCCGGCTACCTC
ACCATCTTCGCCATCAGCGCCATGTACCTGCGCAGGGGCACTCCCTTCGCCAGAGGCAACATGCTGCAGGCGTGG
GAAGCCGGTGTCATCGACACGCTTCACCAGGCGAGTGGCATCATGAAGGTCATTGTCATTATTAGCATCGAGATG
CTGGTCTTCCCACTCTACTGCGGGCTTCTCCTAGACGCCGCTCTCTTGCCTCTGTTTGAGGACACGACCATCAAA
TCTCGCATTCTTTTCACCTACAATTTCCCTCTTACCTCGGTCTTCGTCCATTGGTTCGTCGGGACGGGATACATG
TTCCATTTCGCACTCTTTGTGTCTATGTGCCGGAAGATCATGCGTCCTGGTGTCTTGTGTCAGCTGTGCCATACC
TTGCTCTACTCGTCAGCCGTTGCTAACTTTTTTGCTTGCAGACTTCATTCGAGACCCCGATGACCCCGAGTTTCA
TCCCATCCGCGACGTGCTCGAGAGAAGCCTTACCACGCAGTTGAGGAAGATATTATTCTCCGCCTTCGTGTACGG
CGCTCTCGTCATCGTCTGCCTTGGCGGTGTCGTCTGGTGCCTGTCGTACAGCATGCCAGGCGTGCTGCCGATTCA
CTATTCGTCGAACGAGCCGGTACTCGAGTTCCCGGTCGACCTCCTCTTCTACAACTTCCTCATGCCGCAAGCCGT
CAAGGTGCTCAAGCCAGGCGATGGTCTGCACACCATGTACACTTGGTGGTTCCGCAAATGTGCCCGCGGTCTTCG
GCTCACGTACTTTCTTTTCGGCGAACGGCGGATCGACGAGGAGGGCACTCTGCAGCTCCGCCCTGACTCCCCGAA
TCGCCAATCGCGATATAAGTCGCTCCTTCTGGAACTCAGCGAGCACAACGAGGTCGTTCCAAAGACGTGGCGGGA
CACTTTCGAGGGCGGCAATGCCAAGCCGAATCCGGCGCTATCGAACCGGGAAGAGCATGCGCTGAGAAGGAGAAA
ACGGCAGCTGGTGACTTCCGGCCAGCTTGTTCGCAGTGGACGCTTCGTACGAGCGCCTGCTTCGGACCGCGTCAA
GATCCCCAAGGGTAAACAAGTCTTCTTGCACGTCTCAGAGCTCGGGCGGCGCAAAGACGGCAATGCGGACAATGA
CATCTACGCCTCGGGCCAATACCAAATGGTCTACATCCCGCCAAACTTTCGCCTCAGAATCTTCTTGTTCATCCT
CTTCATTTGGCTTTTCGCGGCGGTGACGGGCGTCGGCATCACGATTGCTCCGCTCGCTCTGGGGCGGAAAATGTT
CAAGGTGCTAATCCCGGAACACATTCGCACCAACGACATTTATGCCTTCAGCATAGGCATTTATGTGCTTGGCAC
CGCAAGCTACTCAGTTTTCTGCATGCAACGCATCCTAGCCGGCGTCCGGGGCTGGATCAATAGGGCCTGGGCCGA
GGTGCTGAGAGGACACGCTCACAGACACGTCTTGTCCGGGCTCGCGCGCGGCGGCAAGCTCGTGTACGCCTACGT
CTTCCTCCTCGTCGTGTTCCCGCTCCTGTTCTCTACGCTCATGGAGCTGTACATCACGATACCGTTGCACACATA
TATGGACCCACCCAAGGCAGCATCAGCATCGGCTGCGTCAACAGCGAAGCAGGCGGGCGACGCTGGCCGCCATAC
CGTCCGGGTCATCCAAGCCTGGACTCTGGGCCTCCTCTATTTGAATCTGGGAACCAGAATGATCTCGTCCCTCTT
CCCTGAAAGCCGGCCAGCTCTGGCTGTGCGTACTGTGATGCGGCGGGGGTGGTTGCGACCGGATATTGGCATCCT
GACCAGGGCGTTTGTCATTCCCGGGCTGGCGGTAGCGACGGTAGCGATGTTTGGCCCGCCTCTGATGGCCAGCTT
GCTCATCAGGCTCGACGTGTTTGGCACCCAGGCCGGGGCCCCCGTGGCCATGATCTACCGACACTCGTATCCCGC
GGCAGCGCTAGCGGCAGCACTGGCAAGACACGCGATCGGGATGGCCACAGTCTTCAAGGGCTGGAAGGCGGGAAT
ACGCGACGAGGCGTATCTGATTGGAGAGCGACTACACAACTTCGGGGCCACCACGGCTGGGGTTCGCAAGGCAAA
GAGAGCGTGGGGAGCAGGACGATCGAGGCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail