Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4747
Gene name
LocationContig_24:42840..44710
Strand-
Gene length (bp)1870
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04880 NUDE_C NUDE protein, C-terminal conserved region 6.7E-42 131 280

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NDE1 PE=3 SV=1 2 599 0.0E+00
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-11 PE=3 SV=1 2 599 2.0E-163
sp|O74689|NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudE PE=1 SV=1 3 401 2.0E-99
sp|Q4X1V0|NDE1_ASPFU Nuclear distribution protein nudE homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nde1 PE=3 SV=1 6 599 9.0E-89
sp|Q4P0N6|NDE1_USTMA Nuclear distribution protein nudE homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NDE1 PE=3 SV=2 30 212 6.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NDE1 PE=3 SV=1 2 599 0.0E+00
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-11 PE=3 SV=1 2 599 2.0E-163
sp|O74689|NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudE PE=1 SV=1 3 401 2.0E-99
sp|Q4X1V0|NDE1_ASPFU Nuclear distribution protein nudE homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nde1 PE=3 SV=1 6 599 9.0E-89
sp|Q4P0N6|NDE1_USTMA Nuclear distribution protein nudE homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NDE1 PE=3 SV=2 30 212 6.0E-28
sp|P0CP39|NDE1_CRYNB Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NDE1 PE=3 SV=1 14 190 1.0E-26
sp|P0CP38|NDE1_CRYNJ Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NDE1 PE=3 SV=1 14 190 1.0E-26
sp|Q5ZKH4|NDEL1_CHICK Nuclear distribution protein nudE-like 1 OS=Gallus gallus GN=NDEL1 PE=2 SV=1 6 180 1.0E-24
sp|Q78PB6|NDEL1_RAT Nuclear distribution protein nudE-like 1 OS=Rattus norvegicus GN=Ndel1 PE=1 SV=1 22 180 3.0E-24
sp|Q9ERR1|NDEL1_MOUSE Nuclear distribution protein nudE-like 1 OS=Mus musculus GN=Ndel1 PE=1 SV=2 22 180 3.0E-24
sp|Q5R8T7|NDEL1_PONAB Nuclear distribution protein nudE-like 1 OS=Pongo abelii GN=NDEL1 PE=2 SV=1 22 180 4.0E-24
sp|O46480|NDEL1_RABIT Nuclear distribution protein nudE-like 1 OS=Oryctolagus cuniculus GN=NDEL1 PE=1 SV=3 22 180 5.0E-24
sp|Q9GZM8|NDEL1_HUMAN Nuclear distribution protein nudE-like 1 OS=Homo sapiens GN=NDEL1 PE=1 SV=1 22 180 5.0E-24
sp|Q4R4S6|NDEL1_MACFA Nuclear distribution protein nudE-like 1 OS=Macaca fascicularis GN=NDEL1 PE=2 SV=2 22 180 1.0E-23
sp|Q6C3S1|NDE1_YARLI Nuclear distribution protein nudE homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDE1 PE=3 SV=1 5 188 2.0E-23
sp|Q9NXR1|NDE1_HUMAN Nuclear distribution protein nudE homolog 1 OS=Homo sapiens GN=NDE1 PE=1 SV=2 6 189 8.0E-23
sp|Q9ES39|NDE1_RAT Nuclear distribution protein nudE homolog 1 OS=Rattus norvegicus GN=Nde1 PE=1 SV=1 22 189 2.0E-22
sp|Q7SXI6|NDL1A_DANRE Nuclear distribution protein nudE-like 1-A OS=Danio rerio GN=ndel1a PE=2 SV=1 4 180 6.0E-22
sp|Q9CZA6|NDE1_MOUSE Nuclear distribution protein nudE homolog 1 OS=Mus musculus GN=Nde1 PE=1 SV=1 22 189 6.0E-22
sp|Q28CJ6|NDEL1_XENTR Nuclear distribution protein nudE-like 1 OS=Xenopus tropicalis GN=ndel1 PE=2 SV=1 7 180 1.0E-21
sp|Q6DK98|NDL1A_XENLA Nuclear distribution protein nudE-like 1-A OS=Xenopus laevis GN=ndel1-a PE=2 SV=1 16 180 1.0E-21
sp|Q66JL0|NDE1_XENTR Nuclear distribution protein nudE homolog 1 OS=Xenopus tropicalis GN=nde1 PE=2 SV=1 16 189 2.0E-21
sp|Q803Q2|NDL1B_DANRE Nuclear distribution protein nudE-like 1-B OS=Danio rerio GN=ndel1b PE=2 SV=1 4 180 3.0E-21
sp|Q66J96|NDE1A_XENLA Nuclear distribution protein nudE homolog 1-A OS=Xenopus laevis GN=nde1-a PE=1 SV=1 16 189 4.0E-21
sp|Q6NRJ5|NDE1B_XENLA Nuclear distribution protein nudE homolog 1-B OS=Xenopus laevis GN=nde1-b PE=2 SV=2 16 189 6.0E-21
sp|Q66IZ7|NDL1B_XENLA Nuclear distribution protein nudE-like 1-B OS=Xenopus laevis GN=ndel1-b PE=2 SV=1 7 180 2.0E-20
sp|Q5ZMC9|NDE1_CHICK Nuclear distribution protein nudE homolog 1 OS=Gallus gallus GN=NDE1 PE=2 SV=1 22 189 3.0E-20
sp|Q9VT70|NDE1_DROME Nuclear distribution protein nudE homolog OS=Drosophila melanogaster GN=nudE PE=2 SV=2 7 180 5.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 41 216 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4747
MAEPPSSPPSEAASAEDALSWYKSQYELLESELAEFRESSRELEQELEKDIERAEKQERVLQEKAEALRFEVEEW
KRKYKESKTEASAAQNALEKEVTTLRDSNRSLQLKLRDIEVANDDFERQARNTTSSLEDMESKYNQAIERGVMME
EEIKAGEQEREKLRIESQRLREELADLKIEAELMQDKIKKHEARHLSNISTDLSVLESPTFDKNPDASPDSAASS
PLVTTPPDTKTLCAAETVSDVRDPPSPPMSDASAPVPRSTSAAKPTAKTAAGVARKSRLPSLDGNATPKPRSRPS
LGTASRPPGGRASGVGVGASLRTPANRSSKARPAGHRIPASNSLSHIRSLTAQMQRLEARVHHARSKLPAPTMTP
PRASPRTASNGSHLPSTITIRSRKRTAGSAASSLAGDETTPTNAASLRGSTSSKSHVPRLSTSGVSRLSFGPLPN
RGPESEMSRPSSRASLSSYARPPSRTEMVPPPRPMSRTSLSGARTPLGRPRSSMSGSMHGHSSSIGRMDEEAVDD
DGGRRTPSRRGTYSKLEIEAGASGIPVPGSGIPTPSSRRQSGSRRTSAGVSRDVSGGRLSAAGGRKLSDLGETY*
Coding >Hirsu2|4747
ATGGCCGAACCGCCATCCTCGCCCCCGAGCGAGGCCGCCAGCGCTGAAGACGCCCTTTCCTGGTACAAATCCCAG
TACGAGCTGCTCGAGTCTGAGCTGGCAGAGTTTCGCGAGTCGAGCCGCGAGCTCGAGCAGGAACTGGAGAAGGAC
ATTGAGCGCGCAGAGAAGCAGGAGAGAGTCCTGCAAGAAAAGGCCGAGGCCCTGAGGTTCGAGGTGGAGGAGTGG
AAGAGGAAATACAAGGAGTCCAAGACGGAGGCCAGCGCCGCCCAAAATGCGCTCGAGAAGGAAGTCACCACGCTC
AGGGACTCCAACCGCTCCCTGCAGCTCAAGCTCAGAGACATCGAAGTCGCCAACGATGACTTCGAGCGCCAGGCA
CGCAACACGACGTCGTCGCTCGAGGACATGGAGTCCAAGTACAACCAGGCCATCGAGCGCGGCGTCATGATGGAG
GAGGAGATCAAGGCAGGCGAGCAGGAGCGGGAGAAGCTGCGCATCGAGTCGCAGAGGCTTCGCGAGGAGCTGGCT
GACCTGAAGATCGAGGCAGAGCTGATGCAGGACAAGATCAAGAAGCACGAGGCTCGCCACCTGTCCAACATCTCG
ACCGACCTGTCCGTCCTCGAGTCGCCCACATTTGACAAGAACCCCGACGCCTCGCCCGACTCGGCCGCCAGCTCG
CCCCTCGTCACGACGCCCCCCGACACCAAGACTCTCTGCGCGGCAGAGACCGTCTCCGACGTGCGCGACCCGCCA
TCGCCTCCCATGTCGGACGCCTCGGCCCCCGTGCCACGATCGACCTCGGCGGCCAAGCCGACGGCCAAGACTGCC
GCCGGCGTCGCCCGCAAGTCTCGACTCCCGTCCCTCGACGGCAACGCGACGCCCAAGCCACGGTCCCGGCCGTCG
CTGGGGACGGCCTCGCGGCCCCCTGGCGGCCGCGCCTCGGGCGTAGGTGTAGGCGCCTCCCTGCGAACCCCCGCC
AACCGATCGTCCAAGGCGCGACCTGCTGGGCATAGGATCCCGGCGTCCAACTCGCTGTCACACATCCGATCCCTC
ACGGCCCAGATGCAGCGCCTGGAAGCCAGGGTGCACCATGCGCGCTCCAAGCTTCCCGCCCCGACCATGACGCCG
CCGCGCGCCTCTCCCAGGACGGCCAGCAACGGCTCACACCTGCCGTCGACGATAACGATCCGTTCCCGGAAGCGC
ACCGCCGGGTCGGCGGCCTCGTCGCTGGCCGGAGACGAGACGACGCCGACCAATGCCGCCAGCCTGCGCGGCTCG
ACATCGTCTAAGAGCCACGTCCCGCGGCTCAGCACGTCGGGGGTGAGCCGGCTCTCGTTCGGGCCGCTGCCCAAT
CGCGGGCCCGAGTCGGAGATGAGCCGGCCGAGCTCCCGCGCCAGCTTGTCGTCATACGCCAGGCCGCCGTCGAGG
ACCGAGATGGTCCCCCCGCCGCGGCCCATGTCGCGAACGTCGCTGTCCGGGGCACGGACGCCGCTCGGCCGGCCA
CGATCCTCCATGAGCGGCTCGATGCACGGCCACTCGTCGAGCATTGGCCGCATGGACGAGGAGGCCGTCGACGAC
GACGGGGGCCGTCGGACGCCCAGCCGGAGAGGGACCTATTCGAAGCTGGAGATTGAGGCGGGCGCGAGCGGCATC
CCGGTCCCGGGCAGCGGCATCCCCACGCCCAGTTCGAGGCGGCAGAGCGGCAGCCGGCGAACGAGCGCGGGCGTG
AGCCGAGACGTCTCGGGGGGCCGGCTGAGCGCGGCGGGCGGTCGAAAGCTGAGCGATCTGGGCGAGACGTACTGA
Transcript >Hirsu2|4747
ATGGCCGAACCGCCATCCTCGCCCCCGAGCGAGGCCGCCAGCGCTGAAGACGCCCTTTCCTGGTACAAATCCCAG
TACGAGCTGCTCGAGTCTGAGCTGGCAGAGTTTCGCGAGTCGAGCCGCGAGCTCGAGCAGGAACTGGAGAAGGAC
ATTGAGCGCGCAGAGAAGCAGGAGAGAGTCCTGCAAGAAAAGGCCGAGGCCCTGAGGTTCGAGGTGGAGGAGTGG
AAGAGGAAATACAAGGAGTCCAAGACGGAGGCCAGCGCCGCCCAAAATGCGCTCGAGAAGGAAGTCACCACGCTC
AGGGACTCCAACCGCTCCCTGCAGCTCAAGCTCAGAGACATCGAAGTCGCCAACGATGACTTCGAGCGCCAGGCA
CGCAACACGACGTCGTCGCTCGAGGACATGGAGTCCAAGTACAACCAGGCCATCGAGCGCGGCGTCATGATGGAG
GAGGAGATCAAGGCAGGCGAGCAGGAGCGGGAGAAGCTGCGCATCGAGTCGCAGAGGCTTCGCGAGGAGCTGGCT
GACCTGAAGATCGAGGCAGAGCTGATGCAGGACAAGATCAAGAAGCACGAGGCTCGCCACCTGTCCAACATCTCG
ACCGACCTGTCCGTCCTCGAGTCGCCCACATTTGACAAGAACCCCGACGCCTCGCCCGACTCGGCCGCCAGCTCG
CCCCTCGTCACGACGCCCCCCGACACCAAGACTCTCTGCGCGGCAGAGACCGTCTCCGACGTGCGCGACCCGCCA
TCGCCTCCCATGTCGGACGCCTCGGCCCCCGTGCCACGATCGACCTCGGCGGCCAAGCCGACGGCCAAGACTGCC
GCCGGCGTCGCCCGCAAGTCTCGACTCCCGTCCCTCGACGGCAACGCGACGCCCAAGCCACGGTCCCGGCCGTCG
CTGGGGACGGCCTCGCGGCCCCCTGGCGGCCGCGCCTCGGGCGTAGGTGTAGGCGCCTCCCTGCGAACCCCCGCC
AACCGATCGTCCAAGGCGCGACCTGCTGGGCATAGGATCCCGGCGTCCAACTCGCTGTCACACATCCGATCCCTC
ACGGCCCAGATGCAGCGCCTGGAAGCCAGGGTGCACCATGCGCGCTCCAAGCTTCCCGCCCCGACCATGACGCCG
CCGCGCGCCTCTCCCAGGACGGCCAGCAACGGCTCACACCTGCCGTCGACGATAACGATCCGTTCCCGGAAGCGC
ACCGCCGGGTCGGCGGCCTCGTCGCTGGCCGGAGACGAGACGACGCCGACCAATGCCGCCAGCCTGCGCGGCTCG
ACATCGTCTAAGAGCCACGTCCCGCGGCTCAGCACGTCGGGGGTGAGCCGGCTCTCGTTCGGGCCGCTGCCCAAT
CGCGGGCCCGAGTCGGAGATGAGCCGGCCGAGCTCCCGCGCCAGCTTGTCGTCATACGCCAGGCCGCCGTCGAGG
ACCGAGATGGTCCCCCCGCCGCGGCCCATGTCGCGAACGTCGCTGTCCGGGGCACGGACGCCGCTCGGCCGGCCA
CGATCCTCCATGAGCGGCTCGATGCACGGCCACTCGTCGAGCATTGGCCGCATGGACGAGGAGGCCGTCGACGAC
GACGGGGGCCGTCGGACGCCCAGCCGGAGAGGGACCTATTCGAAGCTGGAGATTGAGGCGGGCGCGAGCGGCATC
CCGGTCCCGGGCAGCGGCATCCCCACGCCCAGTTCGAGGCGGCAGAGCGGCAGCCGGCGAACGAGCGCGGGCGTG
AGCCGAGACGTCTCGGGGGGCCGGCTGAGCGCGGCGGGCGGTCGAAAGCTGAGCGATCTGGGCGAGACGTACTGA
Gene >Hirsu2|4747
ATGGCCGAACCGCCATCCTCGCCCCCGAGCGAGGCCGCCAGCGCTGAAGACGCCCTTTCCTGGTACAAATCCCAG
TACGAGCTGCTCGAGTCTGAGCTGGCAGAGTTTCGCGAGTCGAGCCGCGAGCTCGAGCAGGAACTGGAGAAGGAC
ATTGAGCGCGCAGAGAAGCAGGAGAGAGTCCTGCAAGAAAAGGCCGAGGCCCTGAGGTTCGAGGTGGAGGAGTGG
AAGGTATGCCTGCAGACATCGGTACCCGCGCCCGCCTCCCGTGCCATCTGACTGATTGACTCCATGGGCGCAGAG
GAAATACAAGGAGTCCAAGACGGAGGCCAGCGCCGCCCAAAATGCGCTCGAGAAGGAAGTCACCACGCTCAGGGA
CTCCAACCGCTCCCTGCAGCTCAAGCTCAGAGACATCGAAGTCGCCAACGATGACTTCGAGCGCCAGGCACGCAA
CACGACGTCGTCGCTCGAGGACATGGAGTCCAAGTACAACCAGGCCATCGAGCGCGGCGTCATGATGGAGGAGGA
GATCAAGGCAGGCGAGCAGGAGCGGGAGAAGCTGCGCATCGAGTCGCAGAGGCTTCGCGAGGAGCTGGCTGACCT
GAAGATCGAGGCAGAGCTGATGCAGGACAAGATCAAGAAGCACGAGGCTCGCCACCTGTCCAACATCTCGACCGA
CCTGTCCGTCCTCGAGTCGCCCACATTTGACAAGAACCCCGACGCCTCGCCCGACTCGGCCGCCAGCTCGCCCCT
CGTCACGACGCCCCCCGACACCAAGACTCTCTGCGCGGCAGAGACCGTCTCCGACGTGCGCGACCCGCCATCGCC
TCCCATGTCGGACGCCTCGGCCCCCGTGCCACGATCGACCTCGGCGGCCAAGCCGACGGCCAAGACTGCCGCCGG
CGTCGCCCGCAAGTCTCGACTCCCGTCCCTCGACGGCAACGCGACGCCCAAGCCACGGTCCCGGCCGTCGCTGGG
GACGGCCTCGCGGCCCCCTGGCGGCCGCGCCTCGGGCGTAGGTGTAGGCGCCTCCCTGCGAACCCCCGCCAACCG
ATCGTCCAAGGCGCGACCTGCTGGGCATAGGATCCCGGCGTCCAACTCGCTGTCACACATCCGATCCCTCACGGC
CCAGATGCAGCGCCTGGAAGCCAGGGTGCACCATGCGCGCTCCAAGCTTCCCGCCCCGACCATGACGCCGCCGCG
CGCCTCTCCCAGGACGGCCAGCAACGGCTCACACCTGCCGTCGACGATAACGATCCGTTCCCGGAAGCGCACCGC
CGGGTCGGCGGCCTCGTCGCTGGCCGGAGACGAGACGACGCCGACCAATGCCGCCAGCCTGCGCGGCTCGACATC
GTCTAAGAGCCACGTCCCGCGGCTCAGCACGTCGGGGGTGAGCCGGCTCTCGTTCGGGCCGCTGCCCAATCGCGG
GCCCGAGTCGGAGATGAGCCGGCCGAGCTCCCGCGCCAGCTTGTCGTCATACGCCAGGCCGCCGTCGAGGACCGA
GATGGTCCCCCCGCCGCGGCCCATGTCGCGAACGTCGCTGTCCGGGGCACGGACGCCGCTCGGCCGGCCACGATC
CTCCATGAGCGGCTCGATGCACGGCCACTCGTCGAGCATTGGCCGCATGGACGAGGAGGCCGTCGACGACGACGG
GGGCCGTCGGACGCCCAGCCGGAGAGGGACCTATTCGAAGCTGGAGATTGAGGCGGGCGCGAGCGGCATCCCGGT
CCCGGGCAGCGGCATCCCCACGCCCAGTTCGAGGCGGCAGAGCGGCAGCCGGCGAACGAGCGCGGGCGTGAGCCG
AGACGTCTCGGGGGGCCGGCTGAGCGCGGCGGGCGGTCGAAAGCTGAGCGATCTGGGCGAGACGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail