Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4743
Gene name
LocationContig_24:15050..17649
Strand-
Gene length (bp)2599
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 5.4E-42 100 517
PF06280 fn3_5 Fn3-like domain 8.3E-16 562 675
PF02225 PA PA domain 1.7E-05 326 383

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 97 623 3.0E-42
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 98 690 1.0E-34
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 98 690 4.0E-34
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 98 690 3.0E-33
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 98 690 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 97 623 3.0E-42
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 98 690 1.0E-34
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 98 690 4.0E-34
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 98 690 3.0E-33
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 98 690 1.0E-32
sp|P15926|C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes GN=scpA PE=1 SV=1 88 682 2.0E-18
sp|Q5X9R0|C5AP_STRP6 C5a peptidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=scpA PE=3 SV=1 88 682 4.0E-18
sp|P0DD35|C5AP_STRPQ C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=scpA PE=3 SV=1 88 682 8.0E-18
sp|P0DD34|C5AP_STRP3 C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=scpA PE=3 SV=1 88 682 8.0E-18
sp|P58099|C5AP_STRP1 C5a peptidase OS=Streptococcus pyogenes serotype M1 GN=scpA PE=3 SV=1 88 573 1.0E-17
sp|Q8NZ80|C5AP_STRP8 C5a peptidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=scpA PE=3 SV=1 88 682 2.0E-17
sp|Q9FHA4|SBT19_ARATH Subtilisin-like protease SBT1.9 OS=Arabidopsis thaliana GN=SBT1.9 PE=2 SV=1 100 514 4.0E-16
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 95 256 1.0E-14
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 87 258 1.0E-14
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 149 514 2.0E-14
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 84 258 3.0E-14
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 70 258 3.0E-14
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 70 258 3.0E-14
sp|Q9FLI4|SBT13_ARATH Subtilisin-like protease SBT1.3 OS=Arabidopsis thaliana GN=SBT1.3 PE=2 SV=1 152 514 8.0E-14
sp|Q39547|CUCM1_CUCME Cucumisin OS=Cucumis melo PE=1 SV=1 152 588 2.0E-13
sp|O64495|SBT12_ARATH Subtilisin-like protease SBT1.2 OS=Arabidopsis thaliana GN=SBT1.2 PE=2 SV=1 139 514 3.0E-13
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 70 254 7.0E-13
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 96 261 7.0E-13
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 70 254 7.0E-13
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 87 235 8.0E-13
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 100 256 4.0E-12
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 84 227 6.0E-12
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 96 278 1.0E-11
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 96 270 5.0E-11
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 89 261 6.0E-11
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 49 254 6.0E-11
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 99 262 6.0E-11
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 105 279 7.0E-11
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 96 270 8.0E-11
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 100 254 1.0E-10
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 96 270 1.0E-10
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 100 254 1.0E-10
sp|Q9LZS6|SBT4F_ARATH Subtilisin-like protease SBT4.15 OS=Arabidopsis thaliana GN=SBT4.15 PE=3 SV=1 103 288 1.0E-10
sp|Q9ZUF6|SBT18_ARATH Subtilisin-like protease SBT1.8 OS=Arabidopsis thaliana GN=SBT1.8 PE=2 SV=1 142 514 2.0E-10
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 4 255 3.0E-10
sp|Q14703|MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens GN=MBTPS1 PE=1 SV=1 89 255 4.0E-10
sp|Q9Z2A8|MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus GN=MBTPS1 PE=1 SV=2 89 255 4.0E-10
sp|Q9WTZ3|MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus GN=Mbtps1 PE=1 SV=2 89 255 5.0E-10
sp|Q9LVJ1|SBT14_ARATH Subtilisin-like protease SBT1.4 OS=Arabidopsis thaliana GN=SBT1.4 PE=2 SV=1 77 514 5.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 7 256 6.0E-10
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 103 261 9.0E-10
sp|Q84WS0|SBT11_ARATH Subtilisin-like protease SBT1.1 OS=Arabidopsis thaliana GN=SBTI1.1 PE=1 SV=1 154 528 3.0E-09
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 100 227 4.0E-09
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 100 254 7.0E-09
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 100 254 7.0E-09
sp|Q9FIG1|SBT4B_ARATH Subtilisin-like protease SBT4.11 OS=Arabidopsis thaliana GN=SBT4.11 PE=2 SV=2 151 255 1.0E-08
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 100 254 1.0E-08
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 100 254 2.0E-08
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 98 279 2.0E-08
sp|Q9FK76|SBT56_ARATH Subtilisin-like protease SBT5.6 OS=Arabidopsis thaliana GN=SBT5.6 PE=2 SV=1 152 654 3.0E-08
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 100 254 3.0E-08
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 100 254 3.0E-08
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 71 255 4.0E-08
sp|Q9FIM8|SBT4A_ARATH Subtilisin-like protease SBT4.10 OS=Arabidopsis thaliana GN=SBT4.10 PE=5 SV=1 8 255 5.0E-08
sp|Q9LUM3|SBT15_ARATH Subtilisin-like protease SBT1.5 OS=Arabidopsis thaliana GN=SBT1.5 PE=2 SV=1 7 259 9.0E-08
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 49 202 1.0E-07
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 100 254 1.0E-07
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 100 254 2.0E-07
sp|Q9SA75|SBT21_ARATH Subtilisin-like protease SBT2.1 OS=Arabidopsis thaliana GN=SBT2.1 PE=2 SV=1 62 255 2.0E-07
sp|Q9RYM8|SUB2_DEIRA Probable subtilase-type serine protease DR_A0283 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0283 PE=1 SV=1 76 253 2.0E-07
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 49 202 2.0E-07
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 100 254 2.0E-07
sp|I1N462|SBT1_SOYBN Subtilisin-like protease Glyma18g48580 OS=Glycine max GN=Glyma18g48580 PE=1 SV=3 154 514 2.0E-07
sp|O49607|SBT16_ARATH Subtilisin-like protease SBT1.6 OS=Arabidopsis thaliana GN=SBT1.6 PE=2 SV=1 152 259 3.0E-07
sp|Q9LNU1|CRSP_ARATH CO(2)-response secreted protease OS=Arabidopsis thaliana GN=CRSP PE=2 SV=1 154 514 3.0E-07
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 50 202 3.0E-07
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 96 261 6.0E-07
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 49 202 1.0E-06
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 94 255 1.0E-06
sp|Q07596|NISP_LACLL Nisin leader peptide-processing serine protease NisP OS=Lactococcus lactis subsp. lactis GN=nisP PE=1 SV=1 101 223 2.0E-06
sp|P58502|TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 103 279 4.0E-06
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 100 254 4.0E-06
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 100 256 7.0E-06
sp|Q8L7D2|SBT4C_ARATH Subtilisin-like protease SBT4.12 OS=Arabidopsis thaliana GN=SBT4.12 PE=2 SV=1 154 255 7.0E-06
sp|Q9C7U8|SBT3H_ARATH Subtilisin-like protease SBT3.17 OS=Arabidopsis thaliana GN=SBT3.17 PE=3 SV=1 152 255 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0008236 serine-type peptidase activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0005618 cell wall Yes
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0030312 external encapsulating structure No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.4203 0.2276 0.9093 0.0631 0.1084 0.0482 0.1816 0.174 0.0911 0.0244

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup13
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|899
Ophiocordyceps australis 1348a (Ghana) OphauG2|6186
Ophiocordyceps australis 1348a (Ghana) OphauG2|5995
Ophiocordyceps australis 1348a (Ghana) OphauG2|2920
Ophiocordyceps australis 1348a (Ghana) OphauG2|2766
Ophiocordyceps australis 1348a (Ghana) OphauG2|2711
Ophiocordyceps australis map64 (Brazil) OphauB2|5626
Ophiocordyceps australis map64 (Brazil) OphauB2|247
Ophiocordyceps australis map64 (Brazil) OphauB2|2915
Ophiocordyceps australis map64 (Brazil) OphauB2|4024
Ophiocordyceps camponoti-floridani Ophcf2|06941
Ophiocordyceps camponoti-floridani Ophcf2|06362
Ophiocordyceps camponoti-rufipedis Ophun1|6441
Ophiocordyceps camponoti-rufipedis Ophun1|2138
Ophiocordyceps kimflemingae Ophio5|4117
Ophiocordyceps kimflemingae Ophio5|496
Ophiocordyceps kimflemingae Ophio5|5244
Ophiocordyceps subramaniannii Hirsu2|6708
Ophiocordyceps subramaniannii Hirsu2|5374
Ophiocordyceps subramaniannii Hirsu2|4743 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4682
Ophiocordyceps subramaniannii Hirsu2|4026
Ophiocordyceps subramaniannii Hirsu2|1356
Ophiocordyceps subramaniannii Hirsu2|11115
Ophiocordyceps subramaniannii Hirsu2|1111
Ophiocordyceps subramaniannii Hirsu2|10934

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4743
MKLDFELFKGVSVQMTDSKNMKATQKAAKIAAMPAVKNIWPVRLYDMPKPKVEWIGTTPRPEAAGRIAARSDGVF
NETGDTFSPHVMTQVDKLRAKGFTGKGIKIAVVDTGIDYKHPALGGCFGPGCLVSFGTDLVGDGYTGSNTPKPDP
DPMDCGGHGTHVAGIVAAQRKGNAFGFTGAAPDAVLGAYRVFGCKGQVSNDVLIAAYNRAYQDGAQIITASIGGP
SGWSEDPWAVAVSRIVDRGVPCTVSAGNEGEQGLFYASGAADGNRVTAVASFDNALTPTLLYGVRYAVDAGPDVK
FGYVPAEPEAWDNVTLPLYATSLDPAVADDACAPLPANTTDLSRRIVLIRRGSCTFADKATHAAARGARYIMFYN
NVPGALSTDLGAVTPPVLAGGMTTPDVGEAWVAALRSGRTVTLKMASRDRTESSLLALPNNATGGALSSYTSWGP
SWEMGLKPQVGTPGGNILSTYPRALGSYAVLSGTSMACPLAAGIVALIAQVRRSFDPVGIENLLSANSNPQRFND
GKKFYDYLAPVAQQGGGLVRAYDAAFASTLLAPSGLSFNDSDHFAGTLNFTITNTAAHAITYRLSHVPAVTMYTL
NSGSIYPAPFPNQAVPGAAAGLALSRDALTLPAGQSATVAVSPTPPAGLDPKRLALWSGWVAVNGSDGSSLSIPY
QGLTGSLRGARVLGSDDVWIAHSTDKLLMPVQPNITFTLPGPGNAVPSSDLPALIANLALGSRLLRADIVPLTTC
PPNMTTQVWGLKTIGQPFSFPSKWNTRGPSPFPWDGRLDSGNYAPPGKYMFVVRALRIFGDETKKGDWDVAESKA
IRIKYL*
Coding >Hirsu2|4743
ATGAAGCTCGACTTTGAGCTCTTCAAGGGCGTCTCGGTGCAAATGACGGACAGCAAGAACATGAAGGCGACGCAG
AAGGCGGCCAAGATCGCGGCCATGCCGGCCGTCAAGAACATCTGGCCCGTCCGCCTCTACGACATGCCCAAGCCC
AAGGTCGAGTGGATCGGCACGACGCCGAGGCCGGAGGCGGCCGGCCGCATCGCCGCTCGGTCCGACGGCGTCTTC
AACGAGACGGGAGACACCTTCTCGCCCCACGTCATGACGCAGGTCGACAAGCTGCGAGCCAAGGGCTTCACGGGC
AAGGGCATCAAGATCGCCGTCGTCGACACGGGTATCGACTATAAGCACCCCGCTCTCGGCGGCTGCTTCGGCCCC
GGCTGCCTTGTGTCGTTCGGGACGGACCTGGTGGGCGACGGCTACACCGGCAGCAACACGCCGAAGCCGGACCCG
GATCCGATGGACTGCGGCGGGCACGGCACGCACGTGGCCGGCATCGTGGCGGCGCAGAGAAAGGGCAACGCCTTC
GGGTTCACGGGGGCGGCGCCGGACGCGGTGCTGGGCGCGTACCGCGTCTTCGGCTGCAAGGGCCAGGTGTCCAAC
GACGTGCTGATCGCGGCCTACAACCGGGCCTACCAGGACGGCGCGCAGATCATCACGGCCTCGATCGGCGGGCCC
AGCGGCTGGTCCGAGGACCCGTGGGCCGTCGCCGTGTCGCGCATCGTCGACCGCGGCGTGCCTTGCACCGTCTCG
GCCGGCAACGAGGGCGAGCAGGGCCTGTTCTACGCCAGCGGCGCGGCCGACGGCAACCGCGTCACGGCTGTGGCC
TCGTTCGACAACGCGCTGACGCCGACGCTGCTGTACGGCGTCCGCTACGCCGTCGACGCCGGGCCCGACGTCAAG
TTCGGCTACGTCCCGGCCGAGCCCGAGGCCTGGGACAACGTGACGCTGCCGCTGTACGCGACCAGCCTCGACCCG
GCCGTGGCCGACGACGCCTGCGCGCCGCTGCCGGCCAACACGACGGACCTGAGCCGTCGCATCGTCCTCATCCGC
CGCGGCAGCTGCACCTTCGCCGACAAGGCCACGCACGCGGCCGCCCGCGGCGCGCGCTACATCATGTTCTACAAC
AACGTGCCGGGCGCGCTGTCGACGGACCTGGGGGCCGTCACGCCCCCCGTGCTGGCCGGCGGCATGACCACGCCC
GACGTCGGCGAGGCCTGGGTCGCCGCCCTCCGCTCCGGCCGCACCGTCACGCTCAAGATGGCCAGCCGCGACCGG
ACCGAGAGCAGCCTGCTGGCGCTGCCCAACAACGCCACCGGCGGCGCCCTCAGCTCCTACACCAGCTGGGGCCCG
TCCTGGGAGATGGGCCTCAAGCCTCAGGTCGGCACCCCCGGCGGCAACATCCTGTCGACCTACCCGCGCGCCCTC
GGCAGCTACGCCGTGCTGTCCGGCACCTCCATGGCCTGCCCCCTGGCCGCCGGCATCGTCGCCCTCATCGCCCAG
GTCCGCCGCTCCTTCGACCCGGTTGGCATCGAGAACCTGCTGTCGGCCAACTCGAACCCGCAGCGCTTCAACGAC
GGCAAGAAATTCTACGACTACCTGGCCCCCGTGGCTCAGCAGGGCGGCGGTCTGGTCCGCGCCTACGACGCCGCC
TTCGCCTCGACCCTGCTGGCGCCCTCGGGCCTGTCTTTCAACGACTCGGACCACTTCGCCGGCACGCTCAACTTC
ACCATCACCAACACGGCCGCCCACGCTATCACCTACCGCCTGTCCCACGTGCCGGCCGTCACCATGTACACCCTC
AACTCAGGCTCCATCTACCCGGCGCCCTTCCCCAACCAGGCCGTCCCGGGCGCCGCCGCCGGCCTCGCCCTGAGC
CGGGACGCCCTGACCCTGCCGGCCGGCCAGTCGGCCACCGTCGCCGTCTCGCCCACGCCGCCCGCCGGCCTCGAC
CCCAAGCGCCTGGCCTTGTGGTCCGGCTGGGTGGCCGTCAACGGCTCCGACGGCAGTTCGCTGTCCATCCCTTAC
CAGGGCCTGACCGGCTCGCTGCGCGGGGCCCGCGTCCTGGGCTCCGACGACGTGTGGATCGCCCACTCGACCGAC
AAGCTGCTTATGCCCGTCCAGCCCAACATCACCTTCACCCTGCCCGGGCCCGGCAACGCCGTCCCCAGCTCCGAC
CTGCCGGCCCTAATCGCCAATCTGGCCCTGGGCTCGCGCCTGCTGCGTGCCGACATCGTGCCCCTGACGACCTGC
CCGCCCAACATGACGACCCAGGTCTGGGGCCTCAAGACCATCGGCCAGCCCTTCAGCTTTCCCTCCAAGTGGAAC
ACTCGCGGGCCTAGCCCCTTCCCCTGGGATGGTCGCCTGGATTCCGGCAACTACGCGCCGCCGGGCAAGTATATG
TTTGTCGTCCGCGCGCTGCGTATCTTCGGAGACGAGACAAAGAAGGGTGACTGGGACGTCGCCGAGTCCAAGGCC
ATCCGCATCAAATACCTGTGA
Transcript >Hirsu2|4743
ATGAAGCTCGACTTTGAGCTCTTCAAGGGCGTCTCGGTGCAAATGACGGACAGCAAGAACATGAAGGCGACGCAG
AAGGCGGCCAAGATCGCGGCCATGCCGGCCGTCAAGAACATCTGGCCCGTCCGCCTCTACGACATGCCCAAGCCC
AAGGTCGAGTGGATCGGCACGACGCCGAGGCCGGAGGCGGCCGGCCGCATCGCCGCTCGGTCCGACGGCGTCTTC
AACGAGACGGGAGACACCTTCTCGCCCCACGTCATGACGCAGGTCGACAAGCTGCGAGCCAAGGGCTTCACGGGC
AAGGGCATCAAGATCGCCGTCGTCGACACGGGTATCGACTATAAGCACCCCGCTCTCGGCGGCTGCTTCGGCCCC
GGCTGCCTTGTGTCGTTCGGGACGGACCTGGTGGGCGACGGCTACACCGGCAGCAACACGCCGAAGCCGGACCCG
GATCCGATGGACTGCGGCGGGCACGGCACGCACGTGGCCGGCATCGTGGCGGCGCAGAGAAAGGGCAACGCCTTC
GGGTTCACGGGGGCGGCGCCGGACGCGGTGCTGGGCGCGTACCGCGTCTTCGGCTGCAAGGGCCAGGTGTCCAAC
GACGTGCTGATCGCGGCCTACAACCGGGCCTACCAGGACGGCGCGCAGATCATCACGGCCTCGATCGGCGGGCCC
AGCGGCTGGTCCGAGGACCCGTGGGCCGTCGCCGTGTCGCGCATCGTCGACCGCGGCGTGCCTTGCACCGTCTCG
GCCGGCAACGAGGGCGAGCAGGGCCTGTTCTACGCCAGCGGCGCGGCCGACGGCAACCGCGTCACGGCTGTGGCC
TCGTTCGACAACGCGCTGACGCCGACGCTGCTGTACGGCGTCCGCTACGCCGTCGACGCCGGGCCCGACGTCAAG
TTCGGCTACGTCCCGGCCGAGCCCGAGGCCTGGGACAACGTGACGCTGCCGCTGTACGCGACCAGCCTCGACCCG
GCCGTGGCCGACGACGCCTGCGCGCCGCTGCCGGCCAACACGACGGACCTGAGCCGTCGCATCGTCCTCATCCGC
CGCGGCAGCTGCACCTTCGCCGACAAGGCCACGCACGCGGCCGCCCGCGGCGCGCGCTACATCATGTTCTACAAC
AACGTGCCGGGCGCGCTGTCGACGGACCTGGGGGCCGTCACGCCCCCCGTGCTGGCCGGCGGCATGACCACGCCC
GACGTCGGCGAGGCCTGGGTCGCCGCCCTCCGCTCCGGCCGCACCGTCACGCTCAAGATGGCCAGCCGCGACCGG
ACCGAGAGCAGCCTGCTGGCGCTGCCCAACAACGCCACCGGCGGCGCCCTCAGCTCCTACACCAGCTGGGGCCCG
TCCTGGGAGATGGGCCTCAAGCCTCAGGTCGGCACCCCCGGCGGCAACATCCTGTCGACCTACCCGCGCGCCCTC
GGCAGCTACGCCGTGCTGTCCGGCACCTCCATGGCCTGCCCCCTGGCCGCCGGCATCGTCGCCCTCATCGCCCAG
GTCCGCCGCTCCTTCGACCCGGTTGGCATCGAGAACCTGCTGTCGGCCAACTCGAACCCGCAGCGCTTCAACGAC
GGCAAGAAATTCTACGACTACCTGGCCCCCGTGGCTCAGCAGGGCGGCGGTCTGGTCCGCGCCTACGACGCCGCC
TTCGCCTCGACCCTGCTGGCGCCCTCGGGCCTGTCTTTCAACGACTCGGACCACTTCGCCGGCACGCTCAACTTC
ACCATCACCAACACGGCCGCCCACGCTATCACCTACCGCCTGTCCCACGTGCCGGCCGTCACCATGTACACCCTC
AACTCAGGCTCCATCTACCCGGCGCCCTTCCCCAACCAGGCCGTCCCGGGCGCCGCCGCCGGCCTCGCCCTGAGC
CGGGACGCCCTGACCCTGCCGGCCGGCCAGTCGGCCACCGTCGCCGTCTCGCCCACGCCGCCCGCCGGCCTCGAC
CCCAAGCGCCTGGCCTTGTGGTCCGGCTGGGTGGCCGTCAACGGCTCCGACGGCAGTTCGCTGTCCATCCCTTAC
CAGGGCCTGACCGGCTCGCTGCGCGGGGCCCGCGTCCTGGGCTCCGACGACGTGTGGATCGCCCACTCGACCGAC
AAGCTGCTTATGCCCGTCCAGCCCAACATCACCTTCACCCTGCCCGGGCCCGGCAACGCCGTCCCCAGCTCCGAC
CTGCCGGCCCTAATCGCCAATCTGGCCCTGGGCTCGCGCCTGCTGCGTGCCGACATCGTGCCCCTGACGACCTGC
CCGCCCAACATGACGACCCAGGTCTGGGGCCTCAAGACCATCGGCCAGCCCTTCAGCTTTCCCTCCAAGTGGAAC
ACTCGCGGGCCTAGCCCCTTCCCCTGGGATGGTCGCCTGGATTCCGGCAACTACGCGCCGCCGGGCAAGTATATG
TTTGTCGTCCGCGCGCTGCGTATCTTCGGAGACGAGACAAAGAAGGGTGACTGGGACGTCGCCGAGTCCAAGGCC
ATCCGCATCAAATACCTGTGA
Gene >Hirsu2|4743
ATGAAGCTCGACTTTGAGCTCTTCAAGGGCGTCTCGGTGCAAATGACGGACAGCAAGAACATGAAGGCGACGCAG
AAGGCGGCCAAGATCGCGGCCATGCCGGCCGTCAAGAACATCTGGCCCGTCCGCCTCTACGACATGCCCAAGCCC
AAGGTCGAGTGGATCGGCACGACGCCGAGGCCGGAGGCGGCCGGCCGCATCGCCGCTCGGTCCGACGGCGTCTTC
AACGAGACGGGAGACACCTTCTCGCCCCACGTCATGACGCAGGTCGACAAGCTGCGAGCCAAGGGCTTCACGGGC
AAGGGCATCAAGATCGCCGTCGTCGACACGGGTGTAAGTCTCCGCCGCCGGACGGCTCCCCGGCCTCCCCAGTGC
CAGCGTTCCGGCTTTTTTTCTTCTCTTCTTCTCTTTCTGCGAGACTGACTGGATGCCGCAGATCGACTATAAGCA
CCCCGCTCTCGGCGGCTGCTTCGGCCCCGGCTGCCTTGTGTCGTTCGGGACGGACCTGGTGGGCGACGGCTACAC
CGGCAGCAACACGCCGAAGCCGGACCCGGATCCGATGGACTGCGGCGGGCACGGCACGCACGTGGCCGGCATCGT
GGCGGCGCAGAGAAAGGGCAACGCCTTCGGGTTCACGGGGGCGGCGCCGGACGCGGTGCTGGGCGCGTACCGCGT
CTTCGGCTGCAAGGGCCAGGTGTCCAACGACGTGCTGATCGCGGCCTACAACCGGGCCTACCAGGACGGCGCGCA
GATCATCACGGCCTCGATCGGCGGGCCCAGCGGCTGGTCCGAGGACCCGTGGGCCGTCGCCGTGTCGCGCATCGT
CGACCGCGGCGTGCCTTGCACCGTCTCGGCCGGCAACGAGGGCGAGCAGGGCCTGTTCTACGCCAGCGGCGCGGC
CGACGGCAACCGCGTCACGGCTGTGGCCTCGTTCGACAACGCGCTGACGCCGACGCTGCTGTACGGCGTCCGCTA
CGCCGTCGACGCCGGGCCCGACGTCAAGTTCGGCTACGTCCCGGCCGAGCCCGAGGCCTGGGACAACGTGACGCT
GCCGCTGTACGCGACCAGCCTCGACCCGGCCGTGGCCGACGACGCCTGCGCGCCGCTGCCGGCCAACACGACGGA
CCTGAGCCGTCGCATCGTCCTCATCCGCCGCGGCAGCTGCACCTTCGCCGACAAGGCCACGCACGCGGCCGCCCG
CGGCGCGCGCTACATCATGTTCTACAACAACGTGCCGGGCGCGCTGTCGACGGACCTGGGGGCCGTCACGCCCCC
CGTGCTGGCCGGCGGCATGACCACGCCCGACGTCGGCGAGGCCTGGGTCGCCGCCCTCCGCTCCGGCCGCACCGT
CACGCTCAAGATGGCCAGCCGCGACCGGACCGAGAGCAGCCTGCTGGCGCTGCCCAACAACGCCACCGGCGGCGC
CCTCAGCTCCTACACCAGCTGGGGCCCGTCCTGGGAGATGGGCCTCAAGCCTCAGGTCGGCACCCCCGGCGGCAA
CATCCTGTCGACCTACCCGCGCGCCCTCGGCAGCTACGCCGTGCTGTCCGGCACCTCCATGGCCTGCCCCCTGGC
CGCCGGCATCGTCGCCCTCATCGCCCAGGTCCGCCGCTCCTTCGACCCGGTTGGCATCGAGAACCTGCTGTCGGC
CAACTCGAACCCGCAGCGCTTCAACGACGGCAAGAAATTCTACGACTACCTGGCCCCCGTGGCTCAGCAGGGCGG
CGGTCTGGTCCGCGCCTACGACGCCGCCTTCGCCTCGACCCTGCTGGCGCCCTCGGGCCTGTCTTTCAACGACTC
GGACCACTTCGCCGGCACGCTCAACTTCACCATCACCAACACGGCCGCCCACGCTATCACCTACCGCCTGTCCCA
CGTGCCGGCCGTCACCATGTACACCCTCAACTCAGGCTCCATCTACCCGGCGCCCTTCCCCAACCAGGCCGTCCC
GGGCGCCGCCGCCGGCCTCGCCCTGAGCCGGGACGCCCTGACCCTGCCGGCCGGCCAGTCGGCCACCGTCGCCGT
CTCGCCCACGCCGCCCGCCGGCCTCGACCCCAAGCGCCTGGCCTTGTGGTCCGGCTGGGTGGCCGTCAACGGCTC
CGACGGCAGTTCGCTGTCCATCCCTTACCAGGGCCTGACCGGCTCGCTGCGCGGGGCCCGCGTCCTGGGCTCCGA
CGACGTGTGGATCGCCCACTCGACCGACAAGCTGCTTATGCCCGTCCAGCCCAACATCACCTTCACCCTGCCCGG
GCCCGGCAACGCCGTCCCCAGCTCCGACCTGCCGGCCCTAATCGCCAATCTGGCCCTGGGCTCGCGCCTGCTGCG
TGCCGACATCGTGCCCCTGACGACCTGCCCGCCCAACATGACGACCCAGGTCTGGGGCCTCAAGACCATCGGCCA
GCCCTTCAGCTTTCCCTCCAAGTGGAACACTCGCGGGCCTAGCCCCTTCCCCTGGGATGGTCGCCTGGATTCCGG
CAACTACGCGCCGCCGGGCAAGTATATGTTTGTCGTCCGCGCGCTGCGTATCTTCGGAGACGAGACAAAGAAGGG
TGACTGGGACGTCGCCGAGTCCAAGGCCATCCGCATCAAATACCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail