Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4743
Gene name
LocationContig_24:15050..17649
Strand-
Gene length (bp)2599
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 2.5E-41 100 518
PF06280 fn3_5 Fn3-like domain 5.8E-14 562 675

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 97 623 3.0E-42
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 98 690 1.0E-34
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 98 690 4.0E-34
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 98 690 3.0E-33
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 98 690 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 97 623 3.0E-42
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 98 690 1.0E-34
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 98 690 4.0E-34
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 98 690 3.0E-33
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 98 690 1.0E-32
sp|P15926|C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes GN=scpA PE=1 SV=1 88 682 2.0E-18
sp|Q5X9R0|C5AP_STRP6 C5a peptidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=scpA PE=3 SV=1 88 682 4.0E-18
sp|P0DD35|C5AP_STRPQ C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=scpA PE=3 SV=1 88 682 8.0E-18
sp|P0DD34|C5AP_STRP3 C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=scpA PE=3 SV=1 88 682 8.0E-18
sp|P58099|C5AP_STRP1 C5a peptidase OS=Streptococcus pyogenes serotype M1 GN=scpA PE=3 SV=1 88 573 1.0E-17
sp|Q8NZ80|C5AP_STRP8 C5a peptidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=scpA PE=3 SV=1 88 682 2.0E-17
sp|Q9FHA4|SBT19_ARATH Subtilisin-like protease SBT1.9 OS=Arabidopsis thaliana GN=SBT1.9 PE=2 SV=1 100 514 4.0E-16
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 95 256 1.0E-14
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 87 258 1.0E-14
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 149 514 2.0E-14
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 84 258 3.0E-14
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 70 258 3.0E-14
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 70 258 3.0E-14
sp|Q9FLI4|SBT13_ARATH Subtilisin-like protease SBT1.3 OS=Arabidopsis thaliana GN=SBT1.3 PE=2 SV=1 152 514 8.0E-14
sp|Q39547|CUCM1_CUCME Cucumisin OS=Cucumis melo PE=1 SV=1 152 588 2.0E-13
sp|O64495|SBT12_ARATH Subtilisin-like protease SBT1.2 OS=Arabidopsis thaliana GN=SBT1.2 PE=2 SV=1 139 514 3.0E-13
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 70 254 7.0E-13
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 96 261 7.0E-13
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 70 254 7.0E-13
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 87 235 8.0E-13
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 100 256 4.0E-12
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 84 227 6.0E-12
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 96 278 1.0E-11
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 96 270 5.0E-11
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 89 261 6.0E-11
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 49 254 6.0E-11
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 99 262 6.0E-11
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 105 279 7.0E-11
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 96 270 8.0E-11
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 100 254 1.0E-10
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 96 270 1.0E-10
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 100 254 1.0E-10
sp|Q9LZS6|SBT4F_ARATH Subtilisin-like protease SBT4.15 OS=Arabidopsis thaliana GN=SBT4.15 PE=3 SV=1 103 288 1.0E-10
sp|Q9ZUF6|SBT18_ARATH Subtilisin-like protease SBT1.8 OS=Arabidopsis thaliana GN=SBT1.8 PE=2 SV=1 142 514 2.0E-10
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 4 255 3.0E-10
sp|Q14703|MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens GN=MBTPS1 PE=1 SV=1 89 255 4.0E-10
sp|Q9Z2A8|MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus GN=MBTPS1 PE=1 SV=2 89 255 4.0E-10
sp|Q9WTZ3|MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus GN=Mbtps1 PE=1 SV=2 89 255 5.0E-10
sp|Q9LVJ1|SBT14_ARATH Subtilisin-like protease SBT1.4 OS=Arabidopsis thaliana GN=SBT1.4 PE=2 SV=1 77 514 5.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 7 256 6.0E-10
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 103 261 9.0E-10
sp|Q84WS0|SBT11_ARATH Subtilisin-like protease SBT1.1 OS=Arabidopsis thaliana GN=SBTI1.1 PE=1 SV=1 154 528 3.0E-09
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 100 227 4.0E-09
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 100 254 7.0E-09
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 100 254 7.0E-09
sp|Q9FIG1|SBT4B_ARATH Subtilisin-like protease SBT4.11 OS=Arabidopsis thaliana GN=SBT4.11 PE=2 SV=2 151 255 1.0E-08
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 100 254 1.0E-08
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 100 254 2.0E-08
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 98 279 2.0E-08
sp|Q9FK76|SBT56_ARATH Subtilisin-like protease SBT5.6 OS=Arabidopsis thaliana GN=SBT5.6 PE=2 SV=1 152 654 3.0E-08
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 100 254 3.0E-08
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 100 254 3.0E-08
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 71 255 4.0E-08
sp|Q9FIM8|SBT4A_ARATH Subtilisin-like protease SBT4.10 OS=Arabidopsis thaliana GN=SBT4.10 PE=5 SV=1 8 255 5.0E-08
sp|Q9LUM3|SBT15_ARATH Subtilisin-like protease SBT1.5 OS=Arabidopsis thaliana GN=SBT1.5 PE=2 SV=1 7 259 9.0E-08
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 49 202 1.0E-07
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 100 254 1.0E-07
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 100 254 2.0E-07
sp|Q9SA75|SBT21_ARATH Subtilisin-like protease SBT2.1 OS=Arabidopsis thaliana GN=SBT2.1 PE=2 SV=1 62 255 2.0E-07
sp|Q9RYM8|SUB2_DEIRA Probable subtilase-type serine protease DR_A0283 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0283 PE=1 SV=1 76 253 2.0E-07
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 49 202 2.0E-07
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 100 254 2.0E-07
sp|I1N462|SBT1_SOYBN Subtilisin-like protease Glyma18g48580 OS=Glycine max GN=Glyma18g48580 PE=1 SV=3 154 514 2.0E-07
sp|O49607|SBT16_ARATH Subtilisin-like protease SBT1.6 OS=Arabidopsis thaliana GN=SBT1.6 PE=2 SV=1 152 259 3.0E-07
sp|Q9LNU1|CRSP_ARATH CO(2)-response secreted protease OS=Arabidopsis thaliana GN=CRSP PE=2 SV=1 154 514 3.0E-07
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 50 202 3.0E-07
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 96 261 6.0E-07
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 49 202 1.0E-06
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 94 255 1.0E-06
sp|Q07596|NISP_LACLL Nisin leader peptide-processing serine protease NisP OS=Lactococcus lactis subsp. lactis GN=nisP PE=1 SV=1 101 223 2.0E-06
sp|P58502|TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 103 279 4.0E-06
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 100 254 4.0E-06
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 100 256 7.0E-06
sp|Q8L7D2|SBT4C_ARATH Subtilisin-like protease SBT4.12 OS=Arabidopsis thaliana GN=SBT4.12 PE=2 SV=1 154 255 7.0E-06
sp|Q9C7U8|SBT3H_ARATH Subtilisin-like protease SBT3.17 OS=Arabidopsis thaliana GN=SBT3.17 PE=3 SV=1 152 255 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0005618 cell wall Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0030312 external encapsulating structure No
GO:0008233 peptidase activity No
GO:0044464 cell part No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4743
MKLDFELFKGVSVQMTDSKNMKATQKAAKIAAMPAVKNIWPVRLYDMPKPKVEWIGTTPRPEAAGRIAARSDGVF
NETGDTFSPHVMTQVDKLRAKGFTGKGIKIAVVDTGIDYKHPALGGCFGPGCLVSFGTDLVGDGYTGSNTPKPDP
DPMDCGGHGTHVAGIVAAQRKGNAFGFTGAAPDAVLGAYRVFGCKGQVSNDVLIAAYNRAYQDGAQIITASIGGP
SGWSEDPWAVAVSRIVDRGVPCTVSAGNEGEQGLFYASGAADGNRVTAVASFDNALTPTLLYGVRYAVDAGPDVK
FGYVPAEPEAWDNVTLPLYATSLDPAVADDACAPLPANTTDLSRRIVLIRRGSCTFADKATHAAARGARYIMFYN
NVPGALSTDLGAVTPPVLAGGMTTPDVGEAWVAALRSGRTVTLKMASRDRTESSLLALPNNATGGALSSYTSWGP
SWEMGLKPQVGTPGGNILSTYPRALGSYAVLSGTSMACPLAAGIVALIAQVRRSFDPVGIENLLSANSNPQRFND
GKKFYDYLAPVAQQGGGLVRAYDAAFASTLLAPSGLSFNDSDHFAGTLNFTITNTAAHAITYRLSHVPAVTMYTL
NSGSIYPAPFPNQAVPGAAAGLALSRDALTLPAGQSATVAVSPTPPAGLDPKRLALWSGWVAVNGSDGSSLSIPY
QGLTGSLRGARVLGSDDVWIAHSTDKLLMPVQPNITFTLPGPGNAVPSSDLPALIANLALGSRLLRADIVPLTTC
PPNMTTQVWGLKTIGQPFSFPSKWNTRGPSPFPWDGRLDSGNYAPPGKYMFVVRALRIFGDETKKGDWDVAESKA
IRIKYL*
Coding >Hirsu2|4743
ATGAAGCTCGACTTTGAGCTCTTCAAGGGCGTCTCGGTGCAAATGACGGACAGCAAGAACATGAAGGCGACGCAG
AAGGCGGCCAAGATCGCGGCCATGCCGGCCGTCAAGAACATCTGGCCCGTCCGCCTCTACGACATGCCCAAGCCC
AAGGTCGAGTGGATCGGCACGACGCCGAGGCCGGAGGCGGCCGGCCGCATCGCCGCTCGGTCCGACGGCGTCTTC
AACGAGACGGGAGACACCTTCTCGCCCCACGTCATGACGCAGGTCGACAAGCTGCGAGCCAAGGGCTTCACGGGC
AAGGGCATCAAGATCGCCGTCGTCGACACGGGTATCGACTATAAGCACCCCGCTCTCGGCGGCTGCTTCGGCCCC
GGCTGCCTTGTGTCGTTCGGGACGGACCTGGTGGGCGACGGCTACACCGGCAGCAACACGCCGAAGCCGGACCCG
GATCCGATGGACTGCGGCGGGCACGGCACGCACGTGGCCGGCATCGTGGCGGCGCAGAGAAAGGGCAACGCCTTC
GGGTTCACGGGGGCGGCGCCGGACGCGGTGCTGGGCGCGTACCGCGTCTTCGGCTGCAAGGGCCAGGTGTCCAAC
GACGTGCTGATCGCGGCCTACAACCGGGCCTACCAGGACGGCGCGCAGATCATCACGGCCTCGATCGGCGGGCCC
AGCGGCTGGTCCGAGGACCCGTGGGCCGTCGCCGTGTCGCGCATCGTCGACCGCGGCGTGCCTTGCACCGTCTCG
GCCGGCAACGAGGGCGAGCAGGGCCTGTTCTACGCCAGCGGCGCGGCCGACGGCAACCGCGTCACGGCTGTGGCC
TCGTTCGACAACGCGCTGACGCCGACGCTGCTGTACGGCGTCCGCTACGCCGTCGACGCCGGGCCCGACGTCAAG
TTCGGCTACGTCCCGGCCGAGCCCGAGGCCTGGGACAACGTGACGCTGCCGCTGTACGCGACCAGCCTCGACCCG
GCCGTGGCCGACGACGCCTGCGCGCCGCTGCCGGCCAACACGACGGACCTGAGCCGTCGCATCGTCCTCATCCGC
CGCGGCAGCTGCACCTTCGCCGACAAGGCCACGCACGCGGCCGCCCGCGGCGCGCGCTACATCATGTTCTACAAC
AACGTGCCGGGCGCGCTGTCGACGGACCTGGGGGCCGTCACGCCCCCCGTGCTGGCCGGCGGCATGACCACGCCC
GACGTCGGCGAGGCCTGGGTCGCCGCCCTCCGCTCCGGCCGCACCGTCACGCTCAAGATGGCCAGCCGCGACCGG
ACCGAGAGCAGCCTGCTGGCGCTGCCCAACAACGCCACCGGCGGCGCCCTCAGCTCCTACACCAGCTGGGGCCCG
TCCTGGGAGATGGGCCTCAAGCCTCAGGTCGGCACCCCCGGCGGCAACATCCTGTCGACCTACCCGCGCGCCCTC
GGCAGCTACGCCGTGCTGTCCGGCACCTCCATGGCCTGCCCCCTGGCCGCCGGCATCGTCGCCCTCATCGCCCAG
GTCCGCCGCTCCTTCGACCCGGTTGGCATCGAGAACCTGCTGTCGGCCAACTCGAACCCGCAGCGCTTCAACGAC
GGCAAGAAATTCTACGACTACCTGGCCCCCGTGGCTCAGCAGGGCGGCGGTCTGGTCCGCGCCTACGACGCCGCC
TTCGCCTCGACCCTGCTGGCGCCCTCGGGCCTGTCTTTCAACGACTCGGACCACTTCGCCGGCACGCTCAACTTC
ACCATCACCAACACGGCCGCCCACGCTATCACCTACCGCCTGTCCCACGTGCCGGCCGTCACCATGTACACCCTC
AACTCAGGCTCCATCTACCCGGCGCCCTTCCCCAACCAGGCCGTCCCGGGCGCCGCCGCCGGCCTCGCCCTGAGC
CGGGACGCCCTGACCCTGCCGGCCGGCCAGTCGGCCACCGTCGCCGTCTCGCCCACGCCGCCCGCCGGCCTCGAC
CCCAAGCGCCTGGCCTTGTGGTCCGGCTGGGTGGCCGTCAACGGCTCCGACGGCAGTTCGCTGTCCATCCCTTAC
CAGGGCCTGACCGGCTCGCTGCGCGGGGCCCGCGTCCTGGGCTCCGACGACGTGTGGATCGCCCACTCGACCGAC
AAGCTGCTTATGCCCGTCCAGCCCAACATCACCTTCACCCTGCCCGGGCCCGGCAACGCCGTCCCCAGCTCCGAC
CTGCCGGCCCTAATCGCCAATCTGGCCCTGGGCTCGCGCCTGCTGCGTGCCGACATCGTGCCCCTGACGACCTGC
CCGCCCAACATGACGACCCAGGTCTGGGGCCTCAAGACCATCGGCCAGCCCTTCAGCTTTCCCTCCAAGTGGAAC
ACTCGCGGGCCTAGCCCCTTCCCCTGGGATGGTCGCCTGGATTCCGGCAACTACGCGCCGCCGGGCAAGTATATG
TTTGTCGTCCGCGCGCTGCGTATCTTCGGAGACGAGACAAAGAAGGGTGACTGGGACGTCGCCGAGTCCAAGGCC
ATCCGCATCAAATACCTGTGA
Transcript >Hirsu2|4743
ATGAAGCTCGACTTTGAGCTCTTCAAGGGCGTCTCGGTGCAAATGACGGACAGCAAGAACATGAAGGCGACGCAG
AAGGCGGCCAAGATCGCGGCCATGCCGGCCGTCAAGAACATCTGGCCCGTCCGCCTCTACGACATGCCCAAGCCC
AAGGTCGAGTGGATCGGCACGACGCCGAGGCCGGAGGCGGCCGGCCGCATCGCCGCTCGGTCCGACGGCGTCTTC
AACGAGACGGGAGACACCTTCTCGCCCCACGTCATGACGCAGGTCGACAAGCTGCGAGCCAAGGGCTTCACGGGC
AAGGGCATCAAGATCGCCGTCGTCGACACGGGTATCGACTATAAGCACCCCGCTCTCGGCGGCTGCTTCGGCCCC
GGCTGCCTTGTGTCGTTCGGGACGGACCTGGTGGGCGACGGCTACACCGGCAGCAACACGCCGAAGCCGGACCCG
GATCCGATGGACTGCGGCGGGCACGGCACGCACGTGGCCGGCATCGTGGCGGCGCAGAGAAAGGGCAACGCCTTC
GGGTTCACGGGGGCGGCGCCGGACGCGGTGCTGGGCGCGTACCGCGTCTTCGGCTGCAAGGGCCAGGTGTCCAAC
GACGTGCTGATCGCGGCCTACAACCGGGCCTACCAGGACGGCGCGCAGATCATCACGGCCTCGATCGGCGGGCCC
AGCGGCTGGTCCGAGGACCCGTGGGCCGTCGCCGTGTCGCGCATCGTCGACCGCGGCGTGCCTTGCACCGTCTCG
GCCGGCAACGAGGGCGAGCAGGGCCTGTTCTACGCCAGCGGCGCGGCCGACGGCAACCGCGTCACGGCTGTGGCC
TCGTTCGACAACGCGCTGACGCCGACGCTGCTGTACGGCGTCCGCTACGCCGTCGACGCCGGGCCCGACGTCAAG
TTCGGCTACGTCCCGGCCGAGCCCGAGGCCTGGGACAACGTGACGCTGCCGCTGTACGCGACCAGCCTCGACCCG
GCCGTGGCCGACGACGCCTGCGCGCCGCTGCCGGCCAACACGACGGACCTGAGCCGTCGCATCGTCCTCATCCGC
CGCGGCAGCTGCACCTTCGCCGACAAGGCCACGCACGCGGCCGCCCGCGGCGCGCGCTACATCATGTTCTACAAC
AACGTGCCGGGCGCGCTGTCGACGGACCTGGGGGCCGTCACGCCCCCCGTGCTGGCCGGCGGCATGACCACGCCC
GACGTCGGCGAGGCCTGGGTCGCCGCCCTCCGCTCCGGCCGCACCGTCACGCTCAAGATGGCCAGCCGCGACCGG
ACCGAGAGCAGCCTGCTGGCGCTGCCCAACAACGCCACCGGCGGCGCCCTCAGCTCCTACACCAGCTGGGGCCCG
TCCTGGGAGATGGGCCTCAAGCCTCAGGTCGGCACCCCCGGCGGCAACATCCTGTCGACCTACCCGCGCGCCCTC
GGCAGCTACGCCGTGCTGTCCGGCACCTCCATGGCCTGCCCCCTGGCCGCCGGCATCGTCGCCCTCATCGCCCAG
GTCCGCCGCTCCTTCGACCCGGTTGGCATCGAGAACCTGCTGTCGGCCAACTCGAACCCGCAGCGCTTCAACGAC
GGCAAGAAATTCTACGACTACCTGGCCCCCGTGGCTCAGCAGGGCGGCGGTCTGGTCCGCGCCTACGACGCCGCC
TTCGCCTCGACCCTGCTGGCGCCCTCGGGCCTGTCTTTCAACGACTCGGACCACTTCGCCGGCACGCTCAACTTC
ACCATCACCAACACGGCCGCCCACGCTATCACCTACCGCCTGTCCCACGTGCCGGCCGTCACCATGTACACCCTC
AACTCAGGCTCCATCTACCCGGCGCCCTTCCCCAACCAGGCCGTCCCGGGCGCCGCCGCCGGCCTCGCCCTGAGC
CGGGACGCCCTGACCCTGCCGGCCGGCCAGTCGGCCACCGTCGCCGTCTCGCCCACGCCGCCCGCCGGCCTCGAC
CCCAAGCGCCTGGCCTTGTGGTCCGGCTGGGTGGCCGTCAACGGCTCCGACGGCAGTTCGCTGTCCATCCCTTAC
CAGGGCCTGACCGGCTCGCTGCGCGGGGCCCGCGTCCTGGGCTCCGACGACGTGTGGATCGCCCACTCGACCGAC
AAGCTGCTTATGCCCGTCCAGCCCAACATCACCTTCACCCTGCCCGGGCCCGGCAACGCCGTCCCCAGCTCCGAC
CTGCCGGCCCTAATCGCCAATCTGGCCCTGGGCTCGCGCCTGCTGCGTGCCGACATCGTGCCCCTGACGACCTGC
CCGCCCAACATGACGACCCAGGTCTGGGGCCTCAAGACCATCGGCCAGCCCTTCAGCTTTCCCTCCAAGTGGAAC
ACTCGCGGGCCTAGCCCCTTCCCCTGGGATGGTCGCCTGGATTCCGGCAACTACGCGCCGCCGGGCAAGTATATG
TTTGTCGTCCGCGCGCTGCGTATCTTCGGAGACGAGACAAAGAAGGGTGACTGGGACGTCGCCGAGTCCAAGGCC
ATCCGCATCAAATACCTGTGA
Gene >Hirsu2|4743
ATGAAGCTCGACTTTGAGCTCTTCAAGGGCGTCTCGGTGCAAATGACGGACAGCAAGAACATGAAGGCGACGCAG
AAGGCGGCCAAGATCGCGGCCATGCCGGCCGTCAAGAACATCTGGCCCGTCCGCCTCTACGACATGCCCAAGCCC
AAGGTCGAGTGGATCGGCACGACGCCGAGGCCGGAGGCGGCCGGCCGCATCGCCGCTCGGTCCGACGGCGTCTTC
AACGAGACGGGAGACACCTTCTCGCCCCACGTCATGACGCAGGTCGACAAGCTGCGAGCCAAGGGCTTCACGGGC
AAGGGCATCAAGATCGCCGTCGTCGACACGGGTGTAAGTCTCCGCCGCCGGACGGCTCCCCGGCCTCCCCAGTGC
CAGCGTTCCGGCTTTTTTTCTTCTCTTCTTCTCTTTCTGCGAGACTGACTGGATGCCGCAGATCGACTATAAGCA
CCCCGCTCTCGGCGGCTGCTTCGGCCCCGGCTGCCTTGTGTCGTTCGGGACGGACCTGGTGGGCGACGGCTACAC
CGGCAGCAACACGCCGAAGCCGGACCCGGATCCGATGGACTGCGGCGGGCACGGCACGCACGTGGCCGGCATCGT
GGCGGCGCAGAGAAAGGGCAACGCCTTCGGGTTCACGGGGGCGGCGCCGGACGCGGTGCTGGGCGCGTACCGCGT
CTTCGGCTGCAAGGGCCAGGTGTCCAACGACGTGCTGATCGCGGCCTACAACCGGGCCTACCAGGACGGCGCGCA
GATCATCACGGCCTCGATCGGCGGGCCCAGCGGCTGGTCCGAGGACCCGTGGGCCGTCGCCGTGTCGCGCATCGT
CGACCGCGGCGTGCCTTGCACCGTCTCGGCCGGCAACGAGGGCGAGCAGGGCCTGTTCTACGCCAGCGGCGCGGC
CGACGGCAACCGCGTCACGGCTGTGGCCTCGTTCGACAACGCGCTGACGCCGACGCTGCTGTACGGCGTCCGCTA
CGCCGTCGACGCCGGGCCCGACGTCAAGTTCGGCTACGTCCCGGCCGAGCCCGAGGCCTGGGACAACGTGACGCT
GCCGCTGTACGCGACCAGCCTCGACCCGGCCGTGGCCGACGACGCCTGCGCGCCGCTGCCGGCCAACACGACGGA
CCTGAGCCGTCGCATCGTCCTCATCCGCCGCGGCAGCTGCACCTTCGCCGACAAGGCCACGCACGCGGCCGCCCG
CGGCGCGCGCTACATCATGTTCTACAACAACGTGCCGGGCGCGCTGTCGACGGACCTGGGGGCCGTCACGCCCCC
CGTGCTGGCCGGCGGCATGACCACGCCCGACGTCGGCGAGGCCTGGGTCGCCGCCCTCCGCTCCGGCCGCACCGT
CACGCTCAAGATGGCCAGCCGCGACCGGACCGAGAGCAGCCTGCTGGCGCTGCCCAACAACGCCACCGGCGGCGC
CCTCAGCTCCTACACCAGCTGGGGCCCGTCCTGGGAGATGGGCCTCAAGCCTCAGGTCGGCACCCCCGGCGGCAA
CATCCTGTCGACCTACCCGCGCGCCCTCGGCAGCTACGCCGTGCTGTCCGGCACCTCCATGGCCTGCCCCCTGGC
CGCCGGCATCGTCGCCCTCATCGCCCAGGTCCGCCGCTCCTTCGACCCGGTTGGCATCGAGAACCTGCTGTCGGC
CAACTCGAACCCGCAGCGCTTCAACGACGGCAAGAAATTCTACGACTACCTGGCCCCCGTGGCTCAGCAGGGCGG
CGGTCTGGTCCGCGCCTACGACGCCGCCTTCGCCTCGACCCTGCTGGCGCCCTCGGGCCTGTCTTTCAACGACTC
GGACCACTTCGCCGGCACGCTCAACTTCACCATCACCAACACGGCCGCCCACGCTATCACCTACCGCCTGTCCCA
CGTGCCGGCCGTCACCATGTACACCCTCAACTCAGGCTCCATCTACCCGGCGCCCTTCCCCAACCAGGCCGTCCC
GGGCGCCGCCGCCGGCCTCGCCCTGAGCCGGGACGCCCTGACCCTGCCGGCCGGCCAGTCGGCCACCGTCGCCGT
CTCGCCCACGCCGCCCGCCGGCCTCGACCCCAAGCGCCTGGCCTTGTGGTCCGGCTGGGTGGCCGTCAACGGCTC
CGACGGCAGTTCGCTGTCCATCCCTTACCAGGGCCTGACCGGCTCGCTGCGCGGGGCCCGCGTCCTGGGCTCCGA
CGACGTGTGGATCGCCCACTCGACCGACAAGCTGCTTATGCCCGTCCAGCCCAACATCACCTTCACCCTGCCCGG
GCCCGGCAACGCCGTCCCCAGCTCCGACCTGCCGGCCCTAATCGCCAATCTGGCCCTGGGCTCGCGCCTGCTGCG
TGCCGACATCGTGCCCCTGACGACCTGCCCGCCCAACATGACGACCCAGGTCTGGGGCCTCAAGACCATCGGCCA
GCCCTTCAGCTTTCCCTCCAAGTGGAACACTCGCGGGCCTAGCCCCTTCCCCTGGGATGGTCGCCTGGATTCCGG
CAACTACGCGCCGCCGGGCAAGTATATGTTTGTCGTCCGCGCGCTGCGTATCTTCGGAGACGAGACAAAGAAGGG
TGACTGGGACGTCGCCGAGTCCAAGGCCATCCGCATCAAATACCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail