Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4742
Gene name
LocationContig_24:12902..14564
Strand+
Gene length (bp)1662
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01687 Flavokinase Riboflavin kinase 8.1E-09 340 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QQ05|RIFK_MAGO7 Riboflavin kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FMN1 PE=3 SV=3 331 492 5.0E-11
sp|Q2UMM4|RIFK_ASPOR Riboflavin kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fmn1 PE=3 SV=1 330 452 3.0E-08
sp|Q6M923|RIFK_NEUCR Riboflavin kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fmn1 PE=3 SV=2 331 392 1.0E-07
sp|Q0CHR1|RIFK_ASPTN Riboflavin kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fmn1 PE=3 SV=1 330 451 3.0E-07
sp|O74866|RIFK_SCHPO Riboflavin kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmn1 PE=1 SV=1 331 389 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QQ05|RIFK_MAGO7 Riboflavin kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FMN1 PE=3 SV=3 331 492 5.0E-11
sp|Q2UMM4|RIFK_ASPOR Riboflavin kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fmn1 PE=3 SV=1 330 452 3.0E-08
sp|Q6M923|RIFK_NEUCR Riboflavin kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fmn1 PE=3 SV=2 331 392 1.0E-07
sp|Q0CHR1|RIFK_ASPTN Riboflavin kinase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fmn1 PE=3 SV=1 330 451 3.0E-07
sp|O74866|RIFK_SCHPO Riboflavin kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmn1 PE=1 SV=1 331 389 1.0E-06
sp|A1C603|RIFK_ASPCL Riboflavin kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fmn1 PE=3 SV=1 330 368 3.0E-06
sp|Q5AW61|RIFK_EMENI Riboflavin kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fmn1 PE=3 SV=1 330 392 3.0E-06
sp|A2QFH1|RIFK_ASPNC Riboflavin kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fmn1 PE=3 SV=1 330 451 5.0E-06
sp|Q4WHD2|RIFK_ASPFU Riboflavin kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fmn1 PE=3 SV=1 330 451 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008531 riboflavin kinase activity Yes
GO:0009231 riboflavin biosynthetic process Yes
GO:0008150 biological_process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006766 vitamin metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0017144 drug metabolic process No
GO:0008152 metabolic process No
GO:0042727 flavin-containing compound biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:0016301 kinase activity No
GO:0046483 heterocycle metabolic process No
GO:0042726 flavin-containing compound metabolic process No
GO:0006771 riboflavin metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4742
MPLPPNTPLAAPTEARALRRVQSSSALSIAAASDGPELSEQQQAATASRWKTALEEAQFVAGGLISRPSESTKHY
SIIRHSHLLVWYRGPSTSVSMTILSDKPLPATRTVWLQEKGYSGNVGMAFKAMVRSTAGWLDVTPVRRAQPEHLA
PVDERGIQRDLERFSRKAAGRARHHVARETHVVRIPAAASDGYFRLVVCTGEGSGRKILCGSPVFRIASTTPDAA
VVRGASLSTMPLEVGVKIATTVGQQVAKKYMGVAGMVVQNRAQKLMLKAPAAVKRAGQAAHVNYHRYGMADAVNE
AWKNSELSRHDSQQWDMKQHLQPQHHSVVPIIGPNAGPELPFPVKFEGKVVPASGRSTAQLGVPTANLTGVPDEI
TTRFGGVFAAWAMVLPAKGLSDIANDWFEAVVTIAPPVGAAPTVAMNSGVCVHIAHDFDGATFFNAKLRVLLMAS
LHAASGPAPDDDPDAAAHLARLHVRDVMTTQASLGRESWSPHETIARMEAIRGQRALPDMLTEATGKVWQQVDRI
PLHWAGVRSEAGARRDQMYGNGGMWIAR*
Coding >Hirsu2|4742
ATGCCGCTGCCGCCCAATACGCCCTTGGCGGCGCCGACGGAAGCCCGGGCCCTTCGGCGGGTGCAGAGCTCGTCT
GCCCTATCAATCGCGGCGGCATCAGACGGGCCGGAGCTGTCGGAGCAGCAGCAGGCAGCAACGGCGTCGAGATGG
AAGACGGCCCTCGAGGAGGCGCAGTTCGTCGCCGGCGGTCTCATCAGCAGGCCAAGCGAGTCGACAAAACACTAC
AGCATCATCCGCCACTCGCACCTCCTGGTCTGGTATCGCGGGCCCTCGACTTCGGTGTCGATGACGATTCTCTCG
GACAAGCCTCTGCCAGCCACACGCACCGTATGGCTTCAGGAAAAGGGCTACTCAGGTAACGTCGGGATGGCGTTT
AAGGCCATGGTCCGCTCCACGGCCGGCTGGCTCGACGTGACGCCCGTGCGTCGGGCCCAGCCCGAGCACCTGGCC
CCCGTCGACGAGCGCGGCATCCAGCGCGACCTCGAGCGCTTCTCCCGGAAGGCCGCGGGCCGGGCGCGGCACCAC
GTCGCGCGCGAGACGCACGTCGTCCGCATCCCGGCCGCCGCCTCGGACGGCTACTTCCGCCTCGTCGTCTGCACC
GGCGAGGGCTCCGGGAGGAAGATCCTGTGTGGAAGCCCCGTCTTCCGCATCGCCAGCACCACGCCCGACGCCGCC
GTCGTGCGTGGCGCCAGCCTGTCGACGATGCCGCTCGAGGTGGGCGTCAAGATCGCCACCACCGTCGGCCAGCAG
GTCGCCAAGAAGTACATGGGCGTCGCCGGCATGGTCGTCCAGAACAGGGCCCAGAAGCTGATGCTCAAGGCCCCG
GCGGCGGTCAAGAGGGCCGGCCAGGCCGCCCACGTCAACTACCATCGCTACGGCATGGCCGACGCCGTCAACGAA
GCCTGGAAGAACAGCGAGCTCTCCCGCCACGACAGCCAGCAGTGGGACATGAAGCAGCACCTTCAGCCGCAGCAC
CACTCCGTCGTCCCCATCATCGGTCCCAACGCCGGGCCCGAGCTGCCCTTCCCCGTCAAGTTTGAGGGGAAAGTC
GTACCCGCCAGCGGGAGGTCGACGGCCCAGCTCGGAGTTCCCACCGCCAACCTGACAGGCGTGCCTGACGAGATC
ACGACCCGGTTCGGCGGCGTCTTCGCGGCCTGGGCCATGGTACTGCCCGCCAAGGGGCTGTCGGATATCGCGAAC
GACTGGTTCGAGGCTGTCGTCACCATCGCGCCTCCCGTTGGCGCAGCGCCCACCGTGGCCATGAATAGCGGCGTC
TGTGTCCACATCGCCCACGACTTTGACGGGGCGACCTTCTTCAACGCCAAACTGAGGGTCCTTCTGATGGCCTCG
CTGCATGCGGCCTCCGGGCCTGCTCCGGACGACGACCCCGACGCGGCGGCTCACCTGGCTAGGCTACACGTACGC
GACGTCATGACGACGCAGGCCAGCCTAGGCCGAGAGTCGTGGTCGCCCCACGAAACGATTGCCAGAATGGAAGCG
ATCAGAGGCCAGAGGGCCCTGCCGGACATGCTGACCGAGGCGACGGGCAAGGTGTGGCAGCAGGTGGATAGGATC
CCGCTGCACTGGGCGGGCGTGCGGTCCGAGGCGGGCGCACGGAGGGACCAGATGTACGGAAACGGCGGCATGTGG
ATTGCGAGGTGA
Transcript >Hirsu2|4742
ATGCCGCTGCCGCCCAATACGCCCTTGGCGGCGCCGACGGAAGCCCGGGCCCTTCGGCGGGTGCAGAGCTCGTCT
GCCCTATCAATCGCGGCGGCATCAGACGGGCCGGAGCTGTCGGAGCAGCAGCAGGCAGCAACGGCGTCGAGATGG
AAGACGGCCCTCGAGGAGGCGCAGTTCGTCGCCGGCGGTCTCATCAGCAGGCCAAGCGAGTCGACAAAACACTAC
AGCATCATCCGCCACTCGCACCTCCTGGTCTGGTATCGCGGGCCCTCGACTTCGGTGTCGATGACGATTCTCTCG
GACAAGCCTCTGCCAGCCACACGCACCGTATGGCTTCAGGAAAAGGGCTACTCAGGTAACGTCGGGATGGCGTTT
AAGGCCATGGTCCGCTCCACGGCCGGCTGGCTCGACGTGACGCCCGTGCGTCGGGCCCAGCCCGAGCACCTGGCC
CCCGTCGACGAGCGCGGCATCCAGCGCGACCTCGAGCGCTTCTCCCGGAAGGCCGCGGGCCGGGCGCGGCACCAC
GTCGCGCGCGAGACGCACGTCGTCCGCATCCCGGCCGCCGCCTCGGACGGCTACTTCCGCCTCGTCGTCTGCACC
GGCGAGGGCTCCGGGAGGAAGATCCTGTGTGGAAGCCCCGTCTTCCGCATCGCCAGCACCACGCCCGACGCCGCC
GTCGTGCGTGGCGCCAGCCTGTCGACGATGCCGCTCGAGGTGGGCGTCAAGATCGCCACCACCGTCGGCCAGCAG
GTCGCCAAGAAGTACATGGGCGTCGCCGGCATGGTCGTCCAGAACAGGGCCCAGAAGCTGATGCTCAAGGCCCCG
GCGGCGGTCAAGAGGGCCGGCCAGGCCGCCCACGTCAACTACCATCGCTACGGCATGGCCGACGCCGTCAACGAA
GCCTGGAAGAACAGCGAGCTCTCCCGCCACGACAGCCAGCAGTGGGACATGAAGCAGCACCTTCAGCCGCAGCAC
CACTCCGTCGTCCCCATCATCGGTCCCAACGCCGGGCCCGAGCTGCCCTTCCCCGTCAAGTTTGAGGGGAAAGTC
GTACCCGCCAGCGGGAGGTCGACGGCCCAGCTCGGAGTTCCCACCGCCAACCTGACAGGCGTGCCTGACGAGATC
ACGACCCGGTTCGGCGGCGTCTTCGCGGCCTGGGCCATGGTACTGCCCGCCAAGGGGCTGTCGGATATCGCGAAC
GACTGGTTCGAGGCTGTCGTCACCATCGCGCCTCCCGTTGGCGCAGCGCCCACCGTGGCCATGAATAGCGGCGTC
TGTGTCCACATCGCCCACGACTTTGACGGGGCGACCTTCTTCAACGCCAAACTGAGGGTCCTTCTGATGGCCTCG
CTGCATGCGGCCTCCGGGCCTGCTCCGGACGACGACCCCGACGCGGCGGCTCACCTGGCTAGGCTACACGTACGC
GACGTCATGACGACGCAGGCCAGCCTAGGCCGAGAGTCGTGGTCGCCCCACGAAACGATTGCCAGAATGGAAGCG
ATCAGAGGCCAGAGGGCCCTGCCGGACATGCTGACCGAGGCGACGGGCAAGGTGTGGCAGCAGGTGGATAGGATC
CCGCTGCACTGGGCGGGCGTGCGGTCCGAGGCGGGCGCACGGAGGGACCAGATGTACGGAAACGGCGGCATGTGG
ATTGCGAGGTGA
Gene >Hirsu2|4742
ATGCCGCTGCCGCCCAATACGCCCTTGGCGGCGCCGACGGAAGCCCGGGCCCTTCGGCGGGTGCAGAGCTCGTCT
GCCCTATCAATCGCGGCGGCATCAGACGGGCCGGAGCTGTCGGAGCAGCAGCAGGCAGCAACGGCGTCGAGATGG
AAGACGGCCCTCGAGGAGGCGCAGTTCGTCGCCGGCGGTCTCATCAGCAGGCCAAGCGAGTCGACAAAACACTAC
AGCATCATCCGCCACTCGCACCTCCTGGTCTGGTATCGCGGGCCCTCGACTTCGGTGTCGATGACGATTCTCTCG
GACAAGCCTCTGCCAGCCACACGCACCGTATGGCTTCAGGAAAAGGGCTACTCAGGTAACGTCGGGATGGCGTTT
AAGGCCATGGTCCGCTCCACGGCCGGCTGGCTCGACGTGACGCCCGTGCGTCGGGCCCAGCCCGAGCACCTGGCC
CCCGTCGACGAGCGCGGCATCCAGCGCGACCTCGAGCGCTTCTCCCGGAAGGCCGCGGGCCGGGCGCGGCACCAC
GTCGCGCGCGAGACGCACGTCGTCCGCATCCCGGCCGCCGCCTCGGACGGCTACTTCCGCCTCGTCGTCTGCACC
GGCGAGGGCTCCGGGAGGAAGATCCTGTGTGGAAGCCCCGTCTTCCGCATCGCCAGCACCACGCCCGACGCCGCC
GTCGTGCGTGGCGCCAGCCTGTCGACGATGCCGCTCGAGGTGGGCGTCAAGATCGCCACCACCGTCGGCCAGCAG
GTCGCCAAGAAGTACATGGGCGTCGCCGGCATGGTCGTCCAGAACAGGGCCCAGAAGCTGATGCTCAAGGCCCCG
GCGGCGGTCAAGAGGGCCGGCCAGGCCGCCCACGTCAACTACCATCGCTACGGCATGGCCGACGCCGTCAACGAA
GCCTGGAAGAACAGCGAGCTCTCCCGCCACGACAGCCAGCAGTGGGACATGAAGCAGCACCTTCAGCCGCAGCAC
CACTCCGTCGTCCCCATCATCGGTCCCAACGCCGGGCCCGAGCTGCCCTTCCCCGTCAAGTTTGAGGGGAAAGTC
GTACCCGCCAGCGGGAGGTCGACGGCCCAGCTCGGAGTTCCCACCGCCAACCTGACAGGCGTGCCTGACGAGATC
ACGACCCGGTTCGGCGGCGTCTTCGCGGCCTGGGCCATGGTACTGCCCGCCAAGGGGCTGTCGGATATCGCGAAC
GACTGGTTCGAGGCTGTCGTCACCATCGCGCCTCCCGTTGGCGCAGCGCCCACCGTGGCCATGAATAGCGGCGTC
TGTGTCCACATCGCCCACGACTTTGACGGGGCGACCTTCTTCAACGCCAAACTGAGGGTCCTTCTGATGGCCTCG
CTGCATGCGGCCTCCGGGCCTGCTCCGGACGACGACCCCGACGCGGCGGCTCACCTGGCTAGGCTACACGTACGC
GACGTCATGACGACGCAGGCCAGCCTAGGCCGAGAGTCGTGGTCGCCCCACGAAACGATTGCCAGAATGGAAGCG
ATCAGAGGCCAGAGGGCCCTGCCGGACATGCTGACCGAGGCGACGGGCAAGGTGTGGCAGCAGGTGGATAGGATC
CCGCTGCACTGGGCGGGCGTGCGGTCCGAGGCGGGCGCACGGAGGGACCAGATGTACGGAAACGGCGGCATGTGG
ATTGCGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail