Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4732
Gene name
LocationContig_2394:44..803
Strand+
Gene length (bp)759
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 2.4E-35 3 228
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 2.8E-15 1 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 1 229 9.0E-22
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 3 228 5.0E-17
sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 15 227 2.0E-16
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 14 228 5.0E-16
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 1 228 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 1 229 9.0E-22
sp|P94549|FADB_BACSU Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 3 228 5.0E-17
sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 15 227 2.0E-16
sp|Q52995|ECHH_RHIME Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 14 228 5.0E-16
sp|Q8BH95|ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 1 228 5.0E-16
sp|P14604|ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 1 228 1.0E-15
sp|Q58DM8|ECHM_BOVIN Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1 5 228 1.0E-15
sp|P9WNN9|ECHA8_MYCTU Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA8 PE=1 SV=1 15 227 1.0E-15
sp|P9WNN8|ECHA8_MYCTO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA8 PE=3 SV=1 15 227 1.0E-15
sp|P64017|ECHA8_MYCBO Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA8 PE=3 SV=1 15 227 1.0E-15
sp|Q5R646|ECHM_PONAB Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1 1 228 1.0E-15
sp|O34893|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 15 228 2.0E-15
sp|Q8GB17|CAID_PROSL Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 15 228 1.0E-14
sp|B4EY26|CAID_PROMH Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 15 228 1.0E-14
sp|P53526|ECH12_MYCLE Probable enoyl-CoA hydratase echA12 OS=Mycobacterium leprae (strain TN) GN=echA12 PE=3 SV=1 1 170 2.0E-14
sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 1 228 2.0E-14
sp|P52046|CRT_CLOAB Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 9 226 3.0E-14
sp|Q869N6|CRTL_DICDI 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0271866 PE=3 SV=1 15 233 1.0E-13
sp|Q1ZXF1|ECHM_DICDI Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1 8 228 2.0E-13
sp|Q7U004|ECH12_MYCBO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA12 PE=3 SV=1 5 170 5.0E-13
sp|P76082|PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) GN=paaF PE=1 SV=1 4 228 6.0E-13
sp|P9WNN7|ECH12_MYCTU Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA12 PE=1 SV=1 5 170 1.0E-12
sp|P9WNN6|ECH12_MYCTO Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA12 PE=3 SV=1 5 170 1.0E-12
sp|B5BL54|CAID_SALPK Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|C0Q4L2|CAID_SALPC Carnitinyl-CoA dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|Q5PIL1|CAID_SALPA Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|Q57TJ1|CAID_SALCH Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|B5F749|CAID_SALA4 Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|B5RGA4|CAID_SALG2 Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|B5R1Q9|CAID_SALEP Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|Q8Z9L5|CAID_SALTI Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 15 228 2.0E-12
sp|Q8ZRX5|CAID_SALTY Carnitinyl-CoA dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiD PE=3 SV=3 15 228 2.0E-12
sp|B4TWR3|CAID_SALSV Carnitinyl-CoA dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|B4TIG9|CAID_SALHS Carnitinyl-CoA dehydratase OS=Salmonella heidelberg (strain SL476) GN=caiD PE=3 SV=1 15 228 2.0E-12
sp|A9MYJ5|CAID_SALPB Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1 15 228 3.0E-12
sp|B5FHG4|CAID_SALDC Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1 15 228 3.0E-12
sp|B4T6J5|CAID_SALNS Carnitinyl-CoA dehydratase OS=Salmonella newport (strain SL254) GN=caiD PE=3 SV=1 15 228 3.0E-12
sp|P34559|ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=3 SV=1 5 229 9.0E-12
sp|P31551|CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) GN=caiD PE=1 SV=4 15 228 1.0E-11
sp|B1IRE0|CAID_ECOLC Carnitinyl-CoA dehydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiD PE=3 SV=1 15 228 1.0E-11
sp|B1LFW9|CAID_ECOSM Carnitinyl-CoA dehydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiD PE=3 SV=1 15 228 1.0E-11
sp|Q8FLA6|CAID_ECOL6 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiD PE=3 SV=3 15 228 1.0E-11
sp|Q0TLV3|CAID_ECOL5 Carnitinyl-CoA dehydratase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiD PE=3 SV=1 15 228 1.0E-11
sp|A9MR28|CAID_SALAR Carnitinyl-CoA dehydratase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiD PE=3 SV=1 15 228 2.0E-11
sp|Q8XA35|CAID_ECO57 Carnitinyl-CoA dehydratase OS=Escherichia coli O157:H7 GN=caiD PE=3 SV=3 15 228 3.0E-11
sp|A8ALR7|CAID_CITK8 Carnitinyl-CoA dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiD PE=3 SV=1 15 225 3.0E-11
sp|P59395|CAID_SHIFL Carnitinyl-CoA dehydratase OS=Shigella flexneri GN=caiD PE=3 SV=2 15 228 3.0E-11
sp|Q9TM10|MENB_CYACA 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Cyanidium caldarium GN=menB PE=3 SV=1 15 227 8.0E-11
sp|Q54HG7|AUHM_DICDI Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1 21 228 1.0E-10
sp|A3QFP3|FADJ_SHELP Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadJ PE=3 SV=1 4 166 5.0E-10
sp|Q9WUR2|ECI2_MOUSE Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 1 185 7.0E-10
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 4 227 1.0E-09
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 13 167 1.0E-09
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 13 167 1.0E-09
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 13 167 1.0E-09
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 13 167 2.0E-09
sp|Q49WG8|MENB_STAS1 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 3 227 2.0E-09
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 4 227 2.0E-09
sp|P45361|CRT_PEPDI Short-chain-enoyl-CoA hydratase (Fragment) OS=Peptoclostridium difficile GN=crt PE=3 SV=1 68 219 4.0E-09
sp|B5XVW2|FADJ_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 15 186 4.0E-09
sp|A5JTM5|CBADH_PSEUC 4-chlorobenzoyl coenzyme A dehalogenase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 3 171 5.0E-09
sp|Q4KFC4|FADB_PSEF5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 4 167 5.0E-09
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 1 165 6.0E-09
sp|A8ADP2|FADJ_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 18 212 8.0E-09
sp|Q9F0Y7|FADB_ENTCL Fatty acid oxidation complex subunit alpha OS=Enterobacter cloacae GN=fadB PE=3 SV=1 4 202 8.0E-09
sp|P23966|MENB_BACSU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) GN=menB PE=1 SV=2 4 227 8.0E-09
sp|O75521|ECI2_HUMAN Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 1 223 9.0E-09
sp|C3K613|FADB_PSEFS Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 3 165 9.0E-09
sp|P9WNP1|ECHA6_MYCTU Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA6 PE=1 SV=1 1 228 1.0E-08
sp|P9WNP0|ECHA6_MYCTO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA6 PE=3 SV=1 1 228 1.0E-08
sp|P64015|ECHA6_MYCBO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 1 228 1.0E-08
sp|Q8DSN0|FABM_STRMU Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fabM PE=3 SV=1 1 227 1.0E-08
sp|P40802|PKSI_BACSU Putative polyketide biosynthesis enoyl-CoA isomerase PksI OS=Bacillus subtilis (strain 168) GN=pksI PE=1 SV=2 1 204 1.0E-08
sp|A8GYG0|FADB_SHEPA Fatty acid oxidation complex subunit alpha OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadB PE=3 SV=1 3 168 1.0E-08
sp|A4WCW6|FADJ_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 15 167 1.0E-08
sp|Q08426|ECHP_HUMAN Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 1 158 1.0E-08
sp|Q83PG1|FADB_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadB PE=3 SV=4 4 202 1.0E-08
sp|Q0SZ36|FADB_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadB PE=3 SV=1 4 202 1.0E-08
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 4 165 1.0E-08
sp|Q86YB7|ECHD2_HUMAN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=1 SV=2 4 227 2.0E-08
sp|Q07ZP8|FADJ_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadJ PE=3 SV=1 13 186 2.0E-08
sp|A8G8D1|FADB_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 4 168 2.0E-08
sp|B5BIZ0|FADB_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|Q5PKQ2|FADB_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 4 167 2.0E-08
sp|Q5LLW6|DMDD_RUEPO Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdD PE=1 SV=1 18 222 2.0E-08
sp|Q5R5M8|ECHP_PONAB Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 8 158 2.0E-08
sp|Q73VC7|ECH17_MYCPA Probable enoyl-CoA hydratase echA17 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=echA17 PE=3 SV=1 18 166 2.0E-08
sp|A9MYB0|FADB_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|Q57HM6|FADB_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 4 202 2.0E-08
sp|B5EZW0|FADB_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|Q9L6L5|FADB_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|B5RFL6|FADB_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|B5QW85|FADB_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|A1RI92|FADJ_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 13 166 2.0E-08
sp|Q8Z3C6|FADB_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 4 202 2.0E-08
sp|P77467|PAAG_ECOLI 1,2-epoxyphenylacetyl-CoA isomerase OS=Escherichia coli (strain K12) GN=paaG PE=1 SV=1 1 227 2.0E-08
sp|A0QJH8|ECH17_MYCA1 Probable enoyl-CoA hydratase echA17 OS=Mycobacterium avium (strain 104) GN=echA17 PE=3 SV=1 18 166 2.0E-08
sp|Q5XIC0|ECI2_RAT Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 1 185 2.0E-08
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 1 187 2.0E-08
sp|B0TLB9|FADB_SHEHH Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1 3 184 3.0E-08
sp|A9N453|FADJ_SALPB Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 18 187 3.0E-08
sp|B5FPN1|FADJ_SALDC Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 18 187 3.0E-08
sp|B4TCA8|FADJ_SALHS Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|B5EZR9|FADJ_SALA4 Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|B5R3R9|FADJ_SALEP Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|Q8ZNA7|FADJ_SALTY Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|Q57LW6|FADJ_SALCH Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|B5RCL3|FADJ_SALG2 Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|Q9CLV5|MENB_PASMU 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Pasteurella multocida (strain Pm70) GN=menB PE=3 SV=1 3 227 4.0E-08
sp|B7LLD0|FADJ_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 15 187 4.0E-08
sp|Q8Z4Z0|FADJ_SALTI Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|B4SZR0|FADJ_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|Q4L549|MENB_STAHJ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menB PE=3 SV=1 4 227 4.0E-08
sp|Q9LCU3|CBAD2_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. GN=fcbB2 PE=1 SV=1 6 135 4.0E-08
sp|B4TQC2|FADJ_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 18 187 4.0E-08
sp|B4SZ85|FADB_SALNS Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 4 202 4.0E-08
sp|A6TC19|FADJ_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadJ PE=3 SV=1 15 166 4.0E-08
sp|O85078|CBAD1_ARTSP 4-chlorobenzoyl coenzyme A dehalogenase-1 OS=Arthrobacter sp. GN=fcbB1 PE=1 SV=2 6 135 4.0E-08
sp|Q5HQC3|MENB_STAEQ 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menB PE=3 SV=1 4 227 4.0E-08
sp|B1LME7|FADJ_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 15 212 4.0E-08
sp|Q8CPQ4|MENB_STAES 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menB PE=3 SV=1 4 227 4.0E-08
sp|B7NP24|FADJ_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 15 212 5.0E-08
sp|Q8DDK6|FADB_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadB PE=3 SV=1 4 168 5.0E-08
sp|Q7MQH9|FADB_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadB PE=3 SV=1 4 168 5.0E-08
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 4 167 5.0E-08
sp|Q50130|ECHA6_MYCLE Probable enoyl-CoA hydratase echA6 OS=Mycobacterium leprae (strain TN) GN=echA6 PE=3 SV=1 12 228 6.0E-08
sp|B7VGL4|FADB_VIBTL Fatty acid oxidation complex subunit alpha OS=Vibrio tasmaniensis (strain LGP32) GN=fadB PE=3 SV=1 3 175 6.0E-08
sp|A4Y897|FADJ_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadJ PE=3 SV=1 13 166 6.0E-08
sp|A8A6V1|FADB_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadB PE=3 SV=1 4 202 6.0E-08
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 4 165 6.0E-08
sp|Q32A21|FADB_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadB PE=3 SV=1 4 202 6.0E-08
sp|B5YY93|FADB_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadB PE=3 SV=1 4 202 6.0E-08
sp|Q8X8I2|FADB_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadB PE=3 SV=1 4 202 6.0E-08
sp|A4VKA3|FADB_PSEU5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 4 167 6.0E-08
sp|A5W6H0|FADB_PSEP1 Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 4 165 7.0E-08
sp|B1J5A5|FADB_PSEPW Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 3 167 7.0E-08
sp|Q9AHY3|FADB_PSEPU Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 4 165 7.0E-08
sp|B7NV20|FADB_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadB PE=3 SV=1 4 202 8.0E-08
sp|B7NFE7|FADB_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadB PE=3 SV=1 4 202 9.0E-08
sp|Q6NYL3|ECHP_DANRE Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 1 135 9.0E-08
sp|B7UNH4|FADB_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadB PE=3 SV=1 4 202 9.0E-08
sp|Q1R466|FADB_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadB PE=3 SV=2 4 202 9.0E-08
sp|B7MHD1|FADB_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadB PE=3 SV=1 4 202 9.0E-08
sp|Q0TAL0|FADB_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadB PE=3 SV=1 4 202 1.0E-07
sp|Q8FBI2|FADB_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadB PE=3 SV=2 4 202 1.0E-07
sp|B7N2F2|FADB_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadB PE=3 SV=1 4 202 1.0E-07
sp|Q3K9D8|FADB_PSEPF Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 4 165 1.0E-07
sp|A1JIG4|FADB_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 4 165 1.0E-07
sp|B1JP63|FADB_YERPY Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|Q66FR8|FADB_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|A4TR27|FADB_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|Q1CN99|FADB_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|A9R754|FADB_YERPG Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|Q8ZAN0|FADB_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|B2K0Z6|FADB_YERPB Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|Q1C2C4|FADB_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|A7FDF2|FADB_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadB PE=3 SV=1 69 165 1.0E-07
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 14 155 2.0E-07
sp|Q93Q12|FADB_PSEOL Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 4 167 2.0E-07
sp|Q7A6A9|MENB_STAAN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain N315) GN=menB PE=1 SV=1 4 227 2.0E-07
sp|Q99V48|MENB_STAAM 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menB PE=3 SV=1 4 227 2.0E-07
sp|Q87TN9|FADB_VIBPA Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadB PE=3 SV=1 3 163 2.0E-07
sp|P9WNN3|ECH17_MYCTU Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA17 PE=1 SV=1 18 166 2.0E-07
sp|P9WNN2|ECH17_MYCTO Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA17 PE=3 SV=1 18 166 2.0E-07
sp|A5U753|ECH17_MYCTA Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=echA17 PE=3 SV=1 18 166 2.0E-07
sp|A1KN36|ECH17_MYCBP Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=echA17 PE=3 SV=1 18 166 2.0E-07
sp|Q7TXE1|ECH17_MYCBO Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA17 PE=1 SV=1 18 166 2.0E-07
sp|Q88L02|FADB_PSEPK Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 4 165 2.0E-07
sp|B1LM32|FADB_ECOSM Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadB PE=3 SV=1 4 165 2.0E-07
sp|A7N1D2|FADB_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadB PE=3 SV=1 3 163 2.0E-07
sp|A7ZPF8|FADJ_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 15 212 2.0E-07
sp|B7M6M2|FADJ_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 15 212 2.0E-07
sp|Q6DAP5|FADB_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadB PE=3 SV=1 4 165 2.0E-07
sp|A6TGM4|FADB_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadB PE=3 SV=1 4 202 3.0E-07
sp|B2TWV4|FADJ_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|B6I6Q4|FADJ_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 4 171 3.0E-07
sp|Q7MZ92|FADB_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 4 179 3.0E-07
sp|P44960|MENB_HAEIN 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menB PE=3 SV=1 3 227 3.0E-07
sp|B5BBA1|FADJ_SALPK Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 18 187 3.0E-07
sp|Q5PCX6|FADJ_SALPA Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 18 187 3.0E-07
sp|Q3YZM2|FADJ_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|Q83QQ0|FADJ_SHIFL Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|B1KCZ3|FADB_SHEWM Fatty acid oxidation complex subunit alpha OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadB PE=3 SV=1 3 168 3.0E-07
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 4 171 3.0E-07
sp|B7LBJ5|FADJ_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|C3LSI3|FADB_VIBCM Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fadB PE=3 SV=1 3 163 3.0E-07
sp|Q9KNI1|FADB_VIBCH Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadB PE=3 SV=1 3 163 3.0E-07
sp|A7ZU51|FADB_ECO24 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadB PE=3 SV=1 4 202 3.0E-07
sp|B5YXY4|FADJ_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 4 202 3.0E-07
sp|A5F465|FADB_VIBC3 Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadB PE=3 SV=1 3 163 3.0E-07
sp|Q8XCP2|FADJ_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 15 167 3.0E-07
sp|B4TNZ1|FADB_SALSV Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadB PE=3 SV=1 4 202 3.0E-07
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 15 212 3.0E-07
sp|B7LTY9|FADB_ESCF3 Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadB PE=3 SV=1 4 202 4.0E-07
sp|Q8FFG4|FADJ_ECOL6 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 18 212 4.0E-07
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 4 171 4.0E-07
sp|B7N5V2|FADJ_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 15 212 4.0E-07
sp|A4XSM8|FADB_PSEMY Fatty acid oxidation complex subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=fadB PE=3 SV=1 13 167 4.0E-07
sp|Q1CHK2|FADJ_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 2 187 4.0E-07
sp|Q8ZD45|FADJ_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 2 187 4.0E-07
sp|Q1C660|FADJ_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 2 187 4.0E-07
sp|A7FGK1|FADJ_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 2 187 4.0E-07
sp|Q0T2E6|FADJ_SHIF8 Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 15 212 5.0E-07
sp|B2TVJ5|FADB_SHIB3 Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|B1IW61|FADB_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|B7M649|FADB_ECO8A Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|B7L9A7|FADB_ECO55 Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 4 171 5.0E-07
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 4 171 5.0E-07
sp|Q668V1|FADJ_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 2 187 5.0E-07
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 4 171 5.0E-07
sp|Q3YVC1|FADB_SHISS Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|P21177|FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadB PE=1 SV=2 4 202 5.0E-07
sp|B1XAK8|FADB_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|C5A020|FADB_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadB PE=3 SV=1 4 202 5.0E-07
sp|A4TM82|FADJ_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 2 187 6.0E-07
sp|Q1I7D4|FADB_PSEE4 Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 4 165 6.0E-07
sp|Q6GI37|MENB_STAAR 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MRSA252) GN=menB PE=3 SV=1 4 227 7.0E-07
sp|Q5HH38|MENB_STAAC 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain COL) GN=menB PE=1 SV=1 4 227 7.0E-07
sp|Q64428|ECHA_RAT Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 14 155 7.0E-07
sp|B7MGV7|FADJ_ECO45 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 15 212 7.0E-07
sp|Q1R972|FADJ_ECOUT Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 15 212 7.0E-07
sp|A1ADI8|FADJ_ECOK1 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 15 212 7.0E-07
sp|B7MY16|FADJ_ECO81 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 15 212 8.0E-07
sp|A8ACZ4|FADB_CITK8 Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadB PE=3 SV=1 4 165 8.0E-07
sp|Q8NXA0|MENB_STAAW 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MW2) GN=menB PE=3 SV=1 4 227 8.0E-07
sp|Q6GAG7|MENB_STAAS 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MSSA476) GN=menB PE=3 SV=1 4 227 8.0E-07
sp|Q0TFA6|FADJ_ECOL5 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 15 212 8.0E-07
sp|B7UFZ8|FADJ_ECO27 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 15 212 8.0E-07
sp|Q31YB7|FADJ_SHIBS Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 15 212 8.0E-07
sp|B1IXA5|FADJ_ECOLC Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 15 212 9.0E-07
sp|A8FP63|FADB_SHESH Fatty acid oxidation complex subunit alpha OS=Shewanella sediminis (strain HAW-EB3) GN=fadB PE=3 SV=1 3 168 9.0E-07
sp|P55100|ECHP_CAVPO Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 5 153 1.0E-06
sp|Q08A39|FADB_SHEFN Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 4 175 1.0E-06
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 7 167 1.0E-06
sp|Q6LW06|FADB_PHOPR Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 3 171 1.0E-06
sp|A1S7L6|FADJ_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadJ PE=3 SV=1 13 166 1.0E-06
sp|A0KEL1|FADB_AERHH Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 4 168 2.0E-06
sp|B6I4I6|FADB_ECOSE Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadB PE=3 SV=1 4 202 2.0E-06
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 3 165 2.0E-06
sp|Q54SS0|ECH1_DICDI Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Dictyostelium discoideum GN=ech1 PE=3 SV=1 63 231 2.0E-06
sp|Q8GYN9|MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana GN=MENB PE=1 SV=2 3 227 2.0E-06
sp|A4STF2|FADB_AERS4 Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 69 171 2.0E-06
sp|A1S1I8|FADB_SHEAM Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadB PE=3 SV=1 15 168 3.0E-06
sp|P77399|FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 15 212 3.0E-06
sp|B1X9L4|FADJ_ECODH Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 15 212 3.0E-06
sp|C4ZVN2|FADJ_ECOBW Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 15 212 3.0E-06
sp|P41942|YKB4_CAEEL Uncharacterized protein B0272.4 OS=Caenorhabditis elegans GN=B0272.4 PE=3 SV=1 31 153 4.0E-06
sp|A6WQ25|FADJ_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1 13 166 4.0E-06
sp|A4WFX4|FADB_ENT38 Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadB PE=3 SV=1 4 165 5.0E-06
sp|A3D684|FADJ_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1 13 166 5.0E-06
sp|Q0HKD1|FADJ_SHESM Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 15 166 5.0E-06
sp|A0KV76|FADJ_SHESA Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1 15 166 5.0E-06
sp|Q0HWN3|FADJ_SHESR Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 15 166 5.0E-06
sp|Q5QXM1|FADJ_IDILO Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 2 238 5.0E-06
sp|Q8ECP7|FADJ_SHEON Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadJ PE=3 SV=2 15 166 6.0E-06
sp|P24162|ECHH_RHOCB Probable enoyl-CoA hydratase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=fadB1 PE=3 SV=1 11 227 7.0E-06
sp|Q32DJ4|FADJ_SHIDS Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 15 212 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Yes
GO:0003824 catalytic activity Yes
GO:0016289 CoA hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016790 thiolester hydrolase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4732
MAESLVRALGLASADPRVRAVVLTSSDADNRVFCAGMDLREGGALPERADRHRDQGGRVALAVFRCAKPVVAAVN
GSAVGVGITMTLGANVRVASRDAKVGFVFGRRGFTLEACSSFFLPRLVGAARALHLVSTGAVYPAGHSLFGPLFS
EVVAPDQVLPTALALAEDMAANVSLLASRLMKDLIFRAPASPEEAHLLESKIFHGLVLGPDAREGRESFLEKRQP
DFQATLDDAPEPYPWWPPVDVRVESKL*
Coding >Hirsu2|4732
ATGGCGGAGTCGCTGGTGCGGGCGCTGGGGCTCGCGTCGGCGGACCCGCGCGTGCGGGCCGTGGTGCTGACCTCG
TCCGACGCCGACAACCGCGTCTTCTGCGCCGGCATGGACCTGCGCGAGGGCGGGGCGCTGCCGGAGCGGGCGGAC
CGGCACCGCGACCAGGGCGGGCGCGTGGCGCTGGCCGTCTTCCGCTGCGCCAAGCCCGTCGTCGCCGCCGTCAAC
GGGTCGGCCGTCGGCGTCGGCATCACCATGACGCTGGGCGCCAACGTCCGCGTCGCCAGCCGCGACGCCAAGGTC
GGCTTCGTCTTCGGCCGCCGCGGCTTCACCCTCGAGGCCTGCAGCAGCTTCTTCCTGCCGCGCCTGGTCGGCGCC
GCCCGCGCCCTCCACCTCGTCTCCACCGGCGCCGTCTACCCGGCCGGCCATTCGCTCTTCGGCCCGCTCTTCAGC
GAGGTCGTCGCGCCCGACCAGGTCCTGCCCACCGCCCTCGCCCTCGCCGAGGACATGGCCGCCAACGTCAGCCTG
CTGGCCTCGCGCCTCATGAAGGACCTCATCTTCCGCGCGCCCGCCTCGCCCGAGGAGGCCCACCTGCTCGAGAGC
AAAATCTTCCACGGCCTCGTCCTCGGCCCGGACGCCCGCGAGGGCCGCGAAAGCTTCCTCGAGAAGCGCCAGCCC
GACTTCCAGGCCACCCTCGACGATGCCCCCGAGCCCTACCCTTGGTGGCCGCCCGTCGACGTCAGGGTCGAGTCC
AAGCTCTGA
Transcript >Hirsu2|4732
ATGGCGGAGTCGCTGGTGCGGGCGCTGGGGCTCGCGTCGGCGGACCCGCGCGTGCGGGCCGTGGTGCTGACCTCG
TCCGACGCCGACAACCGCGTCTTCTGCGCCGGCATGGACCTGCGCGAGGGCGGGGCGCTGCCGGAGCGGGCGGAC
CGGCACCGCGACCAGGGCGGGCGCGTGGCGCTGGCCGTCTTCCGCTGCGCCAAGCCCGTCGTCGCCGCCGTCAAC
GGGTCGGCCGTCGGCGTCGGCATCACCATGACGCTGGGCGCCAACGTCCGCGTCGCCAGCCGCGACGCCAAGGTC
GGCTTCGTCTTCGGCCGCCGCGGCTTCACCCTCGAGGCCTGCAGCAGCTTCTTCCTGCCGCGCCTGGTCGGCGCC
GCCCGCGCCCTCCACCTCGTCTCCACCGGCGCCGTCTACCCGGCCGGCCATTCGCTCTTCGGCCCGCTCTTCAGC
GAGGTCGTCGCGCCCGACCAGGTCCTGCCCACCGCCCTCGCCCTCGCCGAGGACATGGCCGCCAACGTCAGCCTG
CTGGCCTCGCGCCTCATGAAGGACCTCATCTTCCGCGCGCCCGCCTCGCCCGAGGAGGCCCACCTGCTCGAGAGC
AAAATCTTCCACGGCCTCGTCCTCGGCCCGGACGCCCGCGAGGGCCGCGAAAGCTTCCTCGAGAAGCGCCAGCCC
GACTTCCAGGCCACCCTCGACGATGCCCCCGAGCCCTACCCTTGGTGGCCGCCCGTCGACGTCAGGGTCGAGTCC
AAGCTCTGA
Gene >Hirsu2|4732
ATGGCGGAGTCGCTGGTGCGGGCGCTGGGGCTCGCGTCGGCGGACCCGCGCGTGCGGGCCGTGGTGCTGACCTCG
TCCGACGCCGACAACCGCGTCTTCTGCGCCGGCATGGACCTGCGCGAGGGCGGGGCGCTGCCGGAGCGGGCGGAC
CGGCACCGCGACCAGGGCGGGCGCGTGGCGCTGGCCGTCTTCCGCTGCGCCAAGCCCGTCGTCGCCGCCGTCAAC
GGGTCGGCCGTCGGCGTCGGCATCACCATGACGCTGGGCGCCAACGTCCGCGTCGCCAGCCGCGACGCCAAGGTC
GGCTTCGTCTTCGGCCGCCGCGGCTTCACCCTCGAGGCCTGCAGCAGCTTCTTCCTGCCGCGCCTGGTCGGCGCC
GCCCGCGCCCTCCACCTCGTCTCCACCGGCGCCGTCTACCCGGCCGGCCATTCGCTCTTCGGCCCGCTCTTCAGC
GAGGTCGTCGCGCCCGACCAGGTCCTGCCCACCGCCCTCGCCCTCGCCGAGGACATGGCCGCCAACGTCAGCCTG
CTGGCCTCGCGCCTCATGAAGGACCTCATCTTCCGCGCGCCCGCCTCGCCCGAGGAGGCCCACCTGCTCGAGAGC
AAAATCTTCCACGGCCTCGTCCTCGGCCCGGACGCCCGCGAGGGCCGCGAAAGCTTCCTCGAGAAGCGCCAGCCC
GACTTCCAGGCCACCCTCGACGATGCCCCCGAGCCCTACCCTTGGTGGCCGCCCGTCGACGTCAGGGTCGAGTCC
AAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail