Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4731
Gene name
LocationContig_2393:1121..2425
Strand-
Gene length (bp)1304
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.5E-05 33 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 19 237 2.0E-15
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 7 165 8.0E-11
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 7 165 8.0E-11
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 12 185 4.0E-10
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 27 180 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 19 237 2.0E-15
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 7 165 8.0E-11
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 7 165 8.0E-11
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 12 185 4.0E-10
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 27 180 6.0E-10
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 29 137 8.0E-09
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 27 242 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4731
MLLPTPLYSLVVLGLLLVVGLARRLASPLRKVPGPPSSLLTSLVLRWRELNASRTAYVHRLHQQYGPVVRLAPNE
VSFTSWPALKEIYCSGGSGYDKTDFYDMFKVFGTRTLFTMLNKADHAKRKRILADCYANTNIMRSVAIQGIRDRS
RVFLDRCTSATESKTSEIFMALHAYACDCITNHLFHPHGSDCLGTREDEVMMHQSTADDSLQYRLIAHYSPSLHR
LFSGIISLFVKPREVPLVDHYILNTVKHGNVARFTLLNRLSQKDQELGWQTNFEGTPKSPWTSFRS*
Coding >Hirsu2|4731
ATGCTGCTGCCGACGCCCTTATACAGCCTCGTGGTCCTGGGCCTGCTACTCGTCGTTGGGCTGGCCCGCCGTCTA
GCTTCGCCTCTCCGCAAAGTGCCAGGACCGCCCTCGTCTCTGCTGACGTCCCTTGTGCTGAGATGGAGGGAACTC
AATGCCAGCAGGACCGCCTACGTCCATCGACTGCACCAGCAGTACGGCCCCGTGGTCCGCCTTGCGCCTAATGAG
GTTTCCTTCACCTCGTGGCCGGCGCTGAAGGAGATATACTGCTCCGGGGGGAGCGGTTACGACAAGACCGACTTC
TACGACATGTTCAAGGTTTTCGGCACGAGGACCCTGTTCACGATGCTGAACAAGGCAGACCATGCCAAGAGGAAA
AGAATCCTCGCTGATTGCTATGCCAACACCAACATTATGCGCAGCGTCGCCATTCAGGGCATCCGAGACCGTTCT
CGCGTCTTCCTCGACCGCTGCACATCTGCAACAGAAAGCAAAACTTCCGAGATATTCATGGCTCTACACGCCTAC
GCTTGCGACTGCATCACGAATCATCTCTTCCACCCCCACGGTTCGGACTGCCTGGGGACTCGAGAGGATGAGGTC
ATGATGCACCAGTCCACCGCCGACGATAGCCTGCAGTACCGCCTCATCGCTCACTATAGCCCCTCGCTCCATCGG
CTATTCTCAGGAATTATTTCCCTTTTCGTGAAGCCCAGGGAAGTACCGCTTGTCGACCACTACATCTTGAACACG
GTCAAACACGGCAATGTTGCCAGGTTCACCCTCTTGAACCGCCTGAGCCAGAAGGACCAGGAGCTTGGCTGGCAG
ACGAACTTCGAGGGAACCCCGAAGAGCCCGTGGACCAGCTTCCGTTCCTAG
Transcript >Hirsu2|4731
ATGCTGCTGCCGACGCCCTTATACAGCCTCGTGGTCCTGGGCCTGCTACTCGTCGTTGGGCTGGCCCGCCGTCTA
GCTTCGCCTCTCCGCAAAGTGCCAGGACCGCCCTCGTCTCTGCTGACGTCCCTTGTGCTGAGATGGAGGGAACTC
AATGCCAGCAGGACCGCCTACGTCCATCGACTGCACCAGCAGTACGGCCCCGTGGTCCGCCTTGCGCCTAATGAG
GTTTCCTTCACCTCGTGGCCGGCGCTGAAGGAGATATACTGCTCCGGGGGGAGCGGTTACGACAAGACCGACTTC
TACGACATGTTCAAGGTTTTCGGCACGAGGACCCTGTTCACGATGCTGAACAAGGCAGACCATGCCAAGAGGAAA
AGAATCCTCGCTGATTGCTATGCCAACACCAACATTATGCGCAGCGTCGCCATTCAGGGCATCCGAGACCGTTCT
CGCGTCTTCCTCGACCGCTGCACATCTGCAACAGAAAGCAAAACTTCCGAGATATTCATGGCTCTACACGCCTAC
GCTTGCGACTGCATCACGAATCATCTCTTCCACCCCCACGGTTCGGACTGCCTGGGGACTCGAGAGGATGAGGTC
ATGATGCACCAGTCCACCGCCGACGATAGCCTGCAGTACCGCCTCATCGCTCACTATAGCCCCTCGCTCCATCGG
CTATTCTCAGGAATTATTTCCCTTTTCGTGAAGCCCAGGGAAGTACCGCTTGTCGACCACTACATCTTGAACACG
GTCAAACACGGCAATGTTGCCAGGTTCACCCTCTTGAACCGCCTGAGCCAGAAGGACCAGGAGCTTGGCTGGCAG
ACGAACTTCGAGGGAACCCCGAAGAGCCCGTGGACCAGCTTCCGTTCCTAG
Gene >Hirsu2|4731
ATGCTGCTGCCGACGCCCTTATACAGCCTCGTGGTCCTGGGCCTGCTACTCGTCGTTGGGCTGGCCCGCCGTCTA
GCTTCGCCTCTCCGCAAAGTGCCAGGACCGCCCTCGTCTCTGCTGACGTCCCTTGTGCTGAGATGGAGGGAACTC
AATGCCAGCAGGACCGCCTACGTCCATCGACTGCACCAGCAGTACGGCCCCGTGGTCCGCCTTGCGCCTAATGAG
GTTTCCTTCACCTCGTGGCCGGCGCTGAAGGAGATATACTGCTCCGGGGGGAGCGGTTACGACAAGACCGACTTC
TACGACATGTTCAAGGTTTTCGGCACGAGGTGAGCCAAGAAGCGCTTCCCTACGGGCATCTTGTTGCTCCCAATG
CTAACCAACACACCCGAAGGACCCTGTTCACGATGCTGAACAAGGCAGACGTGAGGGTCACAACATGAATTCGCA
TCCGCCTACGTGCTGACCCGCCGCTGCCACATGCTAGCATGCCAAGAGGAAAAGAATCCTCGCTGATTGCTATGC
CAACACCAACATTATGCGCAGCGTCGCCATTCAGGGCATCCGAGACCGTTCTCGCGTCTTCCTCGACCGCTGCAC
ATCTGCAACAGAAAGCAAAACTTCCGAGATATTCGTACGTCGATCACGATATCAACGGGTCCGTGTGGAAATCCG
ACGCTGATCTTATTTGTCCAGATGGGTTTGTCTAGTCAAACCCCGCCACCTTGGATGCTGCGCAGCTAACCGCCG
AAGCTCTACACGCCTACGCTTGCGACTGCATCACGAATCATCTCTTCCACCCCCACGGTTCGGACTGCCTGGGGA
CTCGAGAGGATGAGGTCATGATGCACCAGTCCACCGCCGACGATAGCCTGCAGTGTCAGTGCCACTGGCTGTTCC
CGTAGGCAAAATGTCGCCGGCTGACAATCGTCTTTGACCAGACCGCCTCATCGCTCACTATAGCCCCTCGCTCCA
TCGGCTATTCTCAGGAATTATTTCCCTTTTCGTGAAGCCCAGGGAAGTACCGCTTGTCGACCACTACATCTTGAA
CACGGTCAAACACGGCAATGTTGCCAGGTTCACCCTCTTGAACCGCCTGAGCCAGAAGGACCAGGAGCTTGGTCC
TATTGATACAGCGGCGGAGTGTCTTGATCACATGGTTGCGGGAATAGACACAACAGGGGACGCATTATGCTTTCT
CATGTGGGAGCTGTCGCAGGGACGGTCCCTCCATCACCAGCGCAGGCTGGCAGACGAACTTCGAGGGAACCCCGA
AGAGCCCGTGGACCAGCTTCCGTTCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail