Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|473
Gene name
LocationContig_1095:3291..5221
Strand+
Gene length (bp)1930
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-29 97 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 37 528 2.0E-123
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 77 525 3.0E-121
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 75 350 2.0E-34
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 77 357 7.0E-34
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 53 486 5.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 37 528 2.0E-123
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 77 525 3.0E-121
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 75 350 2.0E-34
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 77 357 7.0E-34
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 53 486 5.0E-29
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 87 458 4.0E-28
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 65 282 3.0E-26
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 27 480 4.0E-19
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 13 479 1.0E-17
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 81 429 1.0E-16
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 77 280 6.0E-16
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 81 348 4.0E-15
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 79 414 4.0E-15
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 16 282 2.0E-12
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 82 471 2.0E-12
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 46 428 8.0E-08
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 72 276 1.0E-06
sp|P27669|UHPC_SALTY Regulatory protein UhpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=uhpC PE=3 SV=1 73 291 1.0E-06
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 128 283 2.0E-06
sp|P09836|UHPC_ECOLI Regulatory protein UhpC OS=Escherichia coli (strain K12) GN=uhpC PE=1 SV=3 64 287 5.0E-06
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 95 283 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 93 115 22
2 135 157 22
3 164 186 22
4 191 213 22
5 225 247 22
6 257 279 22
7 346 368 22
8 378 400 22
9 407 429 22
10 439 461 22
11 468 490 22
12 513 535 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|473
MVQHQDAMPSDVDGKDSRPSDLDGKDSRSSEIAVKDDSRPSRFDGKQGDAVEDEASDVSQGPSAPLAGDVAPPRD
YDVETIERIYRKLDLRIIPAFWILYFLCSAIRSNIGIAQTMNKDAGHDLMTMLRLSPRDVSTALALFYVSYVLFD
FPSNLIMSKLSPRVWMARIVFATGLVGACFAAVHDAWSLKLLRFLLGLVIAGMWPGMAFYLTLFYPPSRTGKRIG
MYFTAAQVSAAVVGLVSAGFQLMDGAGGLVGFQWMFLIYGLVAVVLSLALLWWLPDRPMPPGQERRPSRWLWWLP
ATPEALTGRDAVVHYQDLRRVYHARSWTLKDLGLVLLDWRLWPLCLMYFGVVGVGIGTQLYGSVIIAAIRPQSTD
IQVSLLFAPIWVMDLIAILVVTPVSDRFHRYRAFFFSAAACVQVAGLLTTTFALDNGWARYGGLLLVGFGLGPTV
PICMAWTSEIFQRRHGEVGVAAATALVSGLGNLGSVTTTYALYTGWPEDARRGPHQFRKSNLTMVGILGMSIASA
VLMTVLLGVVGNPPSSKLYDGDSASEIDDGAARRETQQRGFGRLSRWLKKARSA*
Coding >Hirsu2|473
ATGGTCCAGCACCAGGACGCCATGCCGTCCGACGTGGACGGCAAGGACTCAAGGCCGTCCGACTTGGACGGAAAG
GACTCAAGGTCGTCCGAAATCGCCGTCAAGGACGACTCCAGGCCGTCTCGTTTCGACGGCAAGCAAGGCGACGCC
GTCGAGGATGAGGCAAGCGATGTGTCGCAGGGGCCGTCGGCGCCCTTGGCCGGCGACGTCGCTCCTCCACGAGAC
TACGACGTCGAGACCATCGAGCGTATATACCGGAAGCTCGACCTGAGAATCATCCCCGCCTTCTGGATCCTCTAC
TTCCTCTGCTCCGCCATCCGCTCCAACATCGGCATCGCCCAGACGATGAACAAGGACGCCGGCCACGACCTGATG
ACGATGCTCCGCCTCTCCCCCCGGGATGTCTCCACGGCTCTTGCGCTCTTCTACGTCTCCTACGTTCTCTTCGAC
TTCCCCTCCAATCTCATCATGAGCAAGCTGAGTCCCCGCGTCTGGATGGCCCGCATCGTCTTCGCCACCGGCCTC
GTCGGCGCCTGCTTCGCCGCCGTCCACGACGCCTGGTCCCTCAAGCTTCTGCGCTTCCTGCTCGGCCTCGTCATC
GCCGGCATGTGGCCCGGCATGGCATTTTACCTGACCCTCTTCTATCCGCCCTCCCGGACGGGCAAGCGCATCGGC
ATGTACTTCACGGCCGCCCAGGTCTCCGCCGCCGTCGTCGGCCTCGTCTCCGCCGGCTTCCAGCTCATGGACGGC
GCCGGGGGGCTGGTAGGCTTCCAGTGGATGTTCCTCATCTACGGCCTGGTGGCCGTCGTCCTCAGCCTCGCCCTT
CTGTGGTGGCTGCCCGACCGCCCCATGCCGCCGGGCCAGGAGAGACGGCCGTCGCGCTGGCTGTGGTGGCTGCCC
GCGACCCCCGAGGCCCTCACGGGCCGCGACGCCGTCGTCCACTACCAGGACCTTCGCCGCGTCTACCACGCCCGC
TCCTGGACCCTCAAGGATCTCGGCCTCGTCCTGCTGGACTGGCGGCTGTGGCCCCTGTGCCTCATGTACTTCGGC
GTGGTCGGGGTCGGCATCGGCACCCAGCTGTACGGCTCCGTCATCATCGCCGCCATCCGGCCGCAGTCGACCGAC
ATTCAGGTGTCTCTGCTGTTTGCGCCCATCTGGGTCATGGATCTCATTGCGATCCTCGTCGTCACGCCCGTGTCG
GACCGCTTCCATCGCTATCGGGCTTTCTTCTTCTCCGCCGCCGCCTGCGTCCAGGTCGCCGGCCTGCTGACGACG
ACGTTTGCGCTCGACAACGGCTGGGCTAGATACGGCGGACTGCTGCTGGTGGGCTTCGGTCTCGGGCCGACGGTG
CCGATCTGCATGGCCTGGACCTCGGAGATCTTCCAGCGCCGGCACGGCGAGGTCGGCGTCGCTGCCGCGACGGCC
CTGGTGTCCGGGCTGGGCAACCTGGGAAGCGTCACGACGACCTACGCCCTGTACACGGGATGGCCCGAGGACGCC
AGGCGCGGGCCGCACCAGTTTCGCAAGAGCAACCTGACCATGGTGGGCATCCTGGGCATGAGCATCGCCAGCGCC
GTGCTCATGACGGTTCTGCTCGGGGTCGTGGGCAACCCGCCGAGTTCGAAGCTGTACGACGGCGACTCGGCGAGC
GAGATCGACGACGGGGCTGCGAGGCGTGAGACGCAGCAGCGCGGATTCGGGCGGCTCAGCCGTTGGTTGAAGAAG
GCCCGGAGTGCATAG
Transcript >Hirsu2|473
ATGGTCCAGCACCAGGACGCCATGCCGTCCGACGTGGACGGCAAGGACTCAAGGCCGTCCGACTTGGACGGAAAG
GACTCAAGGTCGTCCGAAATCGCCGTCAAGGACGACTCCAGGCCGTCTCGTTTCGACGGCAAGCAAGGCGACGCC
GTCGAGGATGAGGCAAGCGATGTGTCGCAGGGGCCGTCGGCGCCCTTGGCCGGCGACGTCGCTCCTCCACGAGAC
TACGACGTCGAGACCATCGAGCGTATATACCGGAAGCTCGACCTGAGAATCATCCCCGCCTTCTGGATCCTCTAC
TTCCTCTGCTCCGCCATCCGCTCCAACATCGGCATCGCCCAGACGATGAACAAGGACGCCGGCCACGACCTGATG
ACGATGCTCCGCCTCTCCCCCCGGGATGTCTCCACGGCTCTTGCGCTCTTCTACGTCTCCTACGTTCTCTTCGAC
TTCCCCTCCAATCTCATCATGAGCAAGCTGAGTCCCCGCGTCTGGATGGCCCGCATCGTCTTCGCCACCGGCCTC
GTCGGCGCCTGCTTCGCCGCCGTCCACGACGCCTGGTCCCTCAAGCTTCTGCGCTTCCTGCTCGGCCTCGTCATC
GCCGGCATGTGGCCCGGCATGGCATTTTACCTGACCCTCTTCTATCCGCCCTCCCGGACGGGCAAGCGCATCGGC
ATGTACTTCACGGCCGCCCAGGTCTCCGCCGCCGTCGTCGGCCTCGTCTCCGCCGGCTTCCAGCTCATGGACGGC
GCCGGGGGGCTGGTAGGCTTCCAGTGGATGTTCCTCATCTACGGCCTGGTGGCCGTCGTCCTCAGCCTCGCCCTT
CTGTGGTGGCTGCCCGACCGCCCCATGCCGCCGGGCCAGGAGAGACGGCCGTCGCGCTGGCTGTGGTGGCTGCCC
GCGACCCCCGAGGCCCTCACGGGCCGCGACGCCGTCGTCCACTACCAGGACCTTCGCCGCGTCTACCACGCCCGC
TCCTGGACCCTCAAGGATCTCGGCCTCGTCCTGCTGGACTGGCGGCTGTGGCCCCTGTGCCTCATGTACTTCGGC
GTGGTCGGGGTCGGCATCGGCACCCAGCTGTACGGCTCCGTCATCATCGCCGCCATCCGGCCGCAGTCGACCGAC
ATTCAGGTGTCTCTGCTGTTTGCGCCCATCTGGGTCATGGATCTCATTGCGATCCTCGTCGTCACGCCCGTGTCG
GACCGCTTCCATCGCTATCGGGCTTTCTTCTTCTCCGCCGCCGCCTGCGTCCAGGTCGCCGGCCTGCTGACGACG
ACGTTTGCGCTCGACAACGGCTGGGCTAGATACGGCGGACTGCTGCTGGTGGGCTTCGGTCTCGGGCCGACGGTG
CCGATCTGCATGGCCTGGACCTCGGAGATCTTCCAGCGCCGGCACGGCGAGGTCGGCGTCGCTGCCGCGACGGCC
CTGGTGTCCGGGCTGGGCAACCTGGGAAGCGTCACGACGACCTACGCCCTGTACACGGGATGGCCCGAGGACGCC
AGGCGCGGGCCGCACCAGTTTCGCAAGAGCAACCTGACCATGGTGGGCATCCTGGGCATGAGCATCGCCAGCGCC
GTGCTCATGACGGTTCTGCTCGGGGTCGTGGGCAACCCGCCGAGTTCGAAGCTGTACGACGGCGACTCGGCGAGC
GAGATCGACGACGGGGCTGCGAGGCGTGAGACGCAGCAGCGCGGATTCGGGCGGCTCAGCCGTTGGTTGAAGAAG
GCCCGGAGTGCATAG
Gene >Hirsu2|473
ATGGTCCAGCACCAGGACGCCATGCCGTCCGACGTGGACGGCAAGGACTCAAGGCCGTCCGACTTGGACGGAAAG
GACTCAAGGTCGTCCGAAATCGCCGTCAAGGACGACTCCAGGCCGTCTCGTTTCGACGGCAAGCAAGGCGACGCC
GTCGAGGATGAGGCAAGCGATGTGTCGCAGGGGCCGTCGGCGCCCTTGGCCGGCGACGTCGCTCCTCCACGAGAC
TACGACGTCGAGACCATCGAGCGTATATACCGGTACCGAGCTTTCTCTGCCCGCACGACGCCCTGTGGAATCCGT
CGCTCACGCATCCGTCTGCTTGCAGGAAGCTCGACCTGAGAATCATCCCCGGTTCGTCTCCGCCGCCGCGCGCTC
GCTGGATCCTCGCTCACCGCTAAGCCGCAGCCTTCTGGATCCTCTACTTCCTCTGCTCCGCCATCCGCTCCAACA
TCGGCATCGCCCAGACGATGAACAAGGACGCCGGCCACGACCTGATGACGATGCTCCGCCTCTCCCCCCGGGATG
TCTCCACGGCTCTTGCGCTCTTCTACGTCTCCTACGTTCTCTTCGACTTCCCCTCCAATCTCATCATGAGCAAGC
TGAGTCCCCGCGTCTGGATGGCCCGCATCGTCTTCGCCACCGGCCTCGTCGGCGCCTGCTTCGCCGCCGTCCACG
ACGCCTGGTCCCTCAAGCTTCTGCGCTTCCTGCTCGGCCTCGTCATCGCCGGCATGTGGCCCGGCATGGCATTTT
ACCTGACCCTCTTCTATCCGCCCTCCCGGACGGGCAAGCGCATCGGCATGTACTTCACGGCCGCCCAGGTCTCCG
CCGCCGTCGTCGGCCTCGTCTCCGCCGGCTTCCAGCTCATGGACGGCGCCGGGGGGCTGGTAGGCTTCCAGTGGA
TGTTCCTCATCTACGGCCTGGTGGCCGTCGTCCTCAGCCTCGCCCTTCTGTGGTGGCTGCCCGACCGCCCCATGC
CGCCGGGCCAGGAGAGACGGCCGTCGCGCTGGCTGTGGTGGCTGCCCGCGACCCCCGAGGCCCTCACGGGCCGCG
ACGCCGTCGTCCACTACCAGGACCTTCGCCGCGTCTACCACGCCCGCTCCTGGACCCTCAAGGATCTCGGCCTCG
TCCTGCTGGACTGGCGGCTGTGGCCCCTGTGCCTCATGTACTTCGGCGTGGTCGGGGTCGGCATCGGCACCCAGC
TGTACGGCTCCGTCATCATCGCCGCCATCCGGCCGCAGTCGACCGACATTCAGGTGTCTCTGCTGTTTGCGCCCA
TCTGGGTCGTGAGTCCGGCCTCTCCCGTCCCACCTTTGTCACGTACCAAAACTCACCAAGCTCGACAACGTGCAA
GATGGATCTCATTGCGATCCTCGTCGTCACGCCCGTGTCGGACCGCTTCCATCGCTATCGGGCTTTCTTCTTCTC
CGCCGCCGCCTGCGTCCAGGTCGCCGGCCTGCTGACGACGACGTTTGCGCTCGACAACGGCTGGGCTAGATACGG
CGGACTGCTGCTGGTGGGCTTCGGTCTCGGGCCGACGGTGCCGATCTGCATGGCCTGGACCTCGGAGATCTTCCA
GCGCCGGCACGGCGAGGTCGGCGTCGCTGCCGCGACGGCCCTGGTGTCCGGGCTGGGCAACCTGGGAAGCGTCAC
GACGACCTACGCCCTGTACACGGGATGGCCCGAGGACGCCAGGCGCGGGCCGCACCAGTTTCGCAAGAGCAACCT
GACCATGGTGGGCATCCTGGGCATGAGCATCGCCAGCGCCGTGCTCATGACGGTTCTGCTCGGGGTCGTGGGCAA
CCCGCCGAGTTCGAAGCTGTACGACGGCGACTCGGCGAGCGAGATCGACGACGGGGCTGCGAGGCGTGAGACGCA
GCAGCGCGGATTCGGGCGGCTCAGCCGTTGGTTGAAGAAGGCCCGGAGTGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail