Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4725
Gene name
LocationContig_239:24848..26471
Strand+
Gene length (bp)1623
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02176 zf-TRAF TRAF-type zinc finger 2.6E-09 310 367
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-08 172 210
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.7E-08 172 210
PF15227 zf-C3HC4_4 zinc finger of C3HC4-type, RING 1.1E-07 172 210
PF13445 zf-RING_UBOX RING-type zinc-finger 3.6E-07 172 210
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.2E-07 171 213
PF13639 zf-RING_2 Ring finger domain 1.3E-06 172 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens GN=TRAF6 PE=1 SV=1 172 419 1.0E-20
sp|B6CJY4|TRAF6_CERAT TNF receptor-associated factor 6 OS=Cercocebus atys GN=TRAF6 PE=2 SV=1 172 447 2.0E-20
sp|B6CJY5|TRAF6_MACMU TNF receptor-associated factor 6 OS=Macaca mulatta GN=TRAF6 PE=2 SV=1 172 447 2.0E-20
sp|Q3ZCC3|TRAF6_BOVIN TNF receptor-associated factor 6 OS=Bos taurus GN=TRAF6 PE=2 SV=1 172 367 3.0E-20
sp|P70196|TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus GN=Traf6 PE=1 SV=2 172 367 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y4K3|TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens GN=TRAF6 PE=1 SV=1 172 419 1.0E-20
sp|B6CJY4|TRAF6_CERAT TNF receptor-associated factor 6 OS=Cercocebus atys GN=TRAF6 PE=2 SV=1 172 447 2.0E-20
sp|B6CJY5|TRAF6_MACMU TNF receptor-associated factor 6 OS=Macaca mulatta GN=TRAF6 PE=2 SV=1 172 447 2.0E-20
sp|Q3ZCC3|TRAF6_BOVIN TNF receptor-associated factor 6 OS=Bos taurus GN=TRAF6 PE=2 SV=1 172 367 3.0E-20
sp|P70196|TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus GN=Traf6 PE=1 SV=2 172 367 6.0E-20
sp|B5DF45|TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus GN=Traf6 PE=2 SV=1 172 367 2.0E-19
sp|A7XUJ6|TRAF6_PIG TNF receptor-associated factor 6 OS=Sus scrofa GN=TRAF6 PE=2 SV=1 172 367 2.0E-19
sp|Q6DJN2|TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis GN=traf6-b PE=2 SV=1 140 367 3.0E-19
sp|Q28DL4|TRAF6_XENTR TNF receptor-associated factor 6 OS=Xenopus tropicalis GN=traf6 PE=2 SV=1 172 367 1.0E-18
sp|Q3MV19|TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis GN=traf6-a PE=1 SV=1 172 367 5.0E-17
sp|Q6IWL4|TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio GN=traf6 PE=2 SV=2 172 367 2.0E-16
sp|Q60803|TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus GN=Traf3 PE=1 SV=2 132 367 8.0E-14
sp|P70191|TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus GN=Traf5 PE=1 SV=1 162 490 4.0E-13
sp|Q1ZXR0|Y8444_DICDI TNF receptor-associated factor family protein DDB_G0268444 OS=Dictyostelium discoideum GN=DDB_G0268444 PE=2 SV=1 155 417 6.0E-13
sp|O00463|TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens GN=TRAF5 PE=1 SV=2 162 479 7.0E-12
sp|Q8N448|LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens GN=LNX2 PE=1 SV=1 161 263 1.0E-11
sp|Q13114|TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens GN=TRAF3 PE=1 SV=2 158 367 2.0E-11
sp|Q91XL2|LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus GN=Lnx2 PE=1 SV=2 161 263 2.0E-10
sp|Q54FD5|Y0931_DICDI TNF receptor-associated factor family protein DDB_G0290931 OS=Dictyostelium discoideum GN=DDB_G0290931 PE=3 SV=1 245 367 5.0E-10
sp|Q54FC5|Y0965_DICDI TNF receptor-associated factor family protein DDB_G0290965 OS=Dictyostelium discoideum GN=DDB_G0290965 PE=3 SV=1 245 414 1.0E-09
sp|Q7ZW16|RNF41_DANRE E3 ubiquitin-protein ligase NRDP1 OS=Danio rerio GN=rnf41 PE=2 SV=1 158 291 2.0E-09
sp|Q54FB9|Y0971_DICDI TNF receptor-associated factor family protein DDB_G0290971 OS=Dictyostelium discoideum GN=DDB_G0290971 PE=3 SV=1 243 418 3.0E-09
sp|Q69ZS0|PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus GN=Pdzrn3 PE=1 SV=3 162 279 1.0E-08
sp|Q54FG0|Y0883_DICDI TNF receptor-associated factor family protein DDB_G0290883 OS=Dictyostelium discoideum GN=DDB_G0290883 PE=3 SV=1 245 418 3.0E-08
sp|P11467|DG17_DICDI RING finger protein DG17 OS=Dictyostelium discoideum GN=zfaA PE=2 SV=2 245 418 3.0E-08
sp|P68907|PZRN3_RAT E3 ubiquitin-protein ligase PDZRN3 OS=Rattus norvegicus GN=Pdzrn3 PE=1 SV=1 162 279 5.0E-08
sp|Q9UPQ7|PZRN3_HUMAN E3 ubiquitin-protein ligase PDZRN3 OS=Homo sapiens GN=PDZRN3 PE=1 SV=2 162 279 6.0E-08
sp|Q8BH75|RNF41_MOUSE E3 ubiquitin-protein ligase NRDP1 OS=Mus musculus GN=Rnf41 PE=1 SV=1 158 291 6.0E-08
sp|Q5R7T5|RNF41_PONAB E3 ubiquitin-protein ligase NRDP1 OS=Pongo abelii GN=RNF41 PE=2 SV=1 158 291 6.0E-08
sp|Q9H4P4|RNF41_HUMAN E3 ubiquitin-protein ligase NRDP1 OS=Homo sapiens GN=RNF41 PE=1 SV=2 158 291 6.0E-08
sp|Q5FWL3|RNF41_XENLA E3 ubiquitin-protein ligase NRDP1 OS=Xenopus laevis GN=rnf41 PE=2 SV=1 162 291 8.0E-08
sp|Q86AY4|Y2340_DICDI TNF receptor-associated factor family protein DDB_G0272340 OS=Dictyostelium discoideum GN=DDB_G0272340 PE=3 SV=2 172 370 8.0E-08
sp|Q61382|TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus GN=Traf4 PE=1 SV=2 158 423 1.0E-07
sp|P39429|TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus GN=Traf2 PE=1 SV=1 167 356 2.0E-07
sp|Q9BUZ4|TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens GN=TRAF4 PE=1 SV=1 158 367 3.0E-07
sp|Q54C11|Y3202_DICDI TNF receptor-associated factor family protein DDB_G0293202 OS=Dictyostelium discoideum GN=DDB_G0293202 PE=2 SV=1 233 410 5.0E-07
sp|O70263|LNX1_MOUSE E3 ubiquitin-protein ligase LNX OS=Mus musculus GN=Lnx1 PE=1 SV=1 158 289 5.0E-07
sp|Q55GA0|Y7754_DICDI TNF receptor-associated factor family protein DDB_G0267754 OS=Dictyostelium discoideum GN=DDB_G0267754 PE=3 SV=1 243 367 6.0E-07
sp|Q557K0|Y3509_DICDI TNF receptor-associated factor family protein DDB_G0273433/DDB_G0273509 OS=Dictyostelium discoideum GN=DDB_G0273433 PE=3 SV=1 164 406 6.0E-07
sp|Q2KHN1|RN151_HUMAN RING finger protein 151 OS=Homo sapiens GN=RNF151 PE=2 SV=1 150 279 7.0E-07
sp|Q8TBB1|LNX1_HUMAN E3 ubiquitin-protein ligase LNX OS=Homo sapiens GN=LNX1 PE=1 SV=1 158 289 2.0E-06
sp|Q86K46|Y7243_DICDI TNF receptor-associated factor family protein DDB_G0277243 OS=Dictyostelium discoideum GN=DDB_G0277243 PE=3 SV=1 172 424 2.0E-06
sp|Q9CQ29|RN151_MOUSE RING finger protein 151 OS=Mus musculus GN=Rnf151 PE=1 SV=1 158 275 2.0E-06
sp|Q2TBT8|RN151_BOVIN RING finger protein 151 OS=Bos taurus GN=RNF151 PE=2 SV=1 158 275 3.0E-06
sp|Q557K2|Y3435_DICDI TNF receptor-associated factor family protein DDB_G0273435/DDB_G0273505 OS=Dictyostelium discoideum GN=DDB_G0273435 PE=3 SV=1 160 414 5.0E-06
sp|P15918|RAG1_HUMAN V(D)J recombination-activating protein 1 OS=Homo sapiens GN=RAG1 PE=1 SV=2 141 261 6.0E-06
sp|Q922B6|TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 160 488 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4725
MSAPQQQPSPAAEAGGDAAADAAAATPRNRAALRSASVAVSLLRESPSESSDEGLRMSPAAARRFARRNLRRTSA
TPDLVTSLVRPPSPDAVYVAPGVQARLRPGGPSPRATATASDLLLLRPAIPGSDRRSGPLSPPHPSSLDIPKRYG
GGAVFDMYSLTYVSDPDPSLLCPICHDPLVDPVTTPCDHTFCYRCLRRSIASSPSGTTCPIDRDLLAWLDCFTAA
RLIRTQLNSLVVKCPHHGRGCGRELKREVVERHATAECRYRDFSCPDLGCDKKLRCKPKDDACPHTETGCPHCDA
RTDEADLELHLLSCPRAKTRCQGCWQLIYRAQLDAHHQLECDGVETPCPYQDVGCSVRAMRGEMSTHSRLCSFHP
DTPSGIVVRAQRELIQSYGDLGSQVRDMKARQAETDRRLEELTAARRGDGAGDPIVNDNRTMQDLDAGFEEVHQN
LTQLEARQSMWTMNQVMPIREEVTELRNNINMIRMHVNWLLNRSREEGRIRAANNTGASATIRRDSSGEAAPALP
ERRRSSGTEMDLPRL*
Coding >Hirsu2|4725
ATGTCGGCGCCCCAACAGCAGCCGAGCCCGGCAGCGGAAGCCGGGGGCGACGCCGCCGCCGACGCCGCCGCCGCC
ACCCCCCGAAACCGGGCGGCGCTGCGCAGCGCCAGCGTCGCCGTCAGCCTGTTGCGCGAGTCGCCGTCCGAGTCG
AGCGACGAGGGGCTGCGCATGAGCCCTGCAGCCGCCCGGCGCTTCGCCCGACGCAACCTGCGCCGCACCTCGGCC
ACCCCCGACCTCGTCACCAGCCTCGTCCGCCCGCCCTCGCCCGACGCCGTCTATGTCGCTCCCGGGGTCCAGGCC
CGCCTCCGGCCCGGCGGGCCTTCGCCGAGGGCCACCGCCACCGCCTCCGACCTGCTGCTCCTCCGCCCGGCCATC
CCCGGCTCCGACCGGCGCTCCGGCCCCCTCTCGCCCCCGCACCCGTCCTCTCTCGACATCCCGAAGCGATACGGA
GGCGGCGCCGTCTTCGACATGTACTCCCTCACCTACGTCTCCGATCCCGACCCCAGCCTCCTGTGCCCCATCTGC
CACGATCCGCTCGTCGATCCCGTCACGACGCCCTGCGACCATACCTTTTGCTACCGCTGCCTACGCCGCAGCATC
GCCTCGAGCCCGTCCGGCACCACCTGTCCCATCGACAGGGACCTTCTTGCCTGGCTCGACTGCTTCACCGCCGCC
AGGCTGATCCGCACCCAGCTCAATAGCCTCGTCGTCAAGTGCCCCCACCACGGCCGCGGCTGCGGCCGCGAGCTC
AAGCGCGAGGTCGTCGAGAGGCACGCGACGGCCGAATGCCGGTACCGAGACTTCTCCTGTCCCGATCTCGGCTGC
GACAAGAAGCTGCGCTGCAAGCCCAAGGACGACGCCTGCCCCCACACGGAGACGGGCTGCCCGCACTGCGACGCC
AGGACGGACGAGGCCGACCTCGAGCTGCACCTGCTGTCGTGCCCCCGAGCCAAGACCCGCTGCCAGGGCTGCTGG
CAGCTGATCTATCGCGCCCAGCTCGACGCCCACCACCAGCTCGAGTGTGACGGCGTCGAGACGCCGTGTCCCTAT
CAGGACGTCGGCTGCTCCGTGCGGGCCATGCGCGGCGAGATGAGCACCCACTCCCGCCTGTGTTCCTTCCACCCG
GACACGCCCTCGGGCATCGTCGTCCGGGCGCAGCGGGAGCTGATCCAGTCGTACGGCGACCTCGGGAGCCAGGTC
CGCGACATGAAGGCGCGCCAGGCCGAGACGGACCGCCGCCTCGAGGAGCTGACGGCGGCGCGCCGCGGTGACGGC
GCCGGCGACCCCATCGTCAACGACAACCGCACCATGCAGGACCTGGACGCCGGCTTCGAAGAGGTGCACCAGAAC
CTGACGCAGCTCGAGGCGCGGCAGAGCATGTGGACGATGAACCAGGTGATGCCGATCCGGGAAGAGGTGACGGAG
CTCCGGAACAACATCAACATGATCCGGATGCACGTCAACTGGCTGCTCAACAGGAGCCGCGAGGAGGGCCGCATC
AGGGCGGCCAACAATACGGGCGCCTCGGCCACGATCCGGCGCGACAGCTCGGGTGAGGCTGCCCCCGCGCTGCCC
GAGAGGAGGCGCTCATCGGGAACGGAGATGGACCTGCCGCGGCTGTGA
Transcript >Hirsu2|4725
ATGTCGGCGCCCCAACAGCAGCCGAGCCCGGCAGCGGAAGCCGGGGGCGACGCCGCCGCCGACGCCGCCGCCGCC
ACCCCCCGAAACCGGGCGGCGCTGCGCAGCGCCAGCGTCGCCGTCAGCCTGTTGCGCGAGTCGCCGTCCGAGTCG
AGCGACGAGGGGCTGCGCATGAGCCCTGCAGCCGCCCGGCGCTTCGCCCGACGCAACCTGCGCCGCACCTCGGCC
ACCCCCGACCTCGTCACCAGCCTCGTCCGCCCGCCCTCGCCCGACGCCGTCTATGTCGCTCCCGGGGTCCAGGCC
CGCCTCCGGCCCGGCGGGCCTTCGCCGAGGGCCACCGCCACCGCCTCCGACCTGCTGCTCCTCCGCCCGGCCATC
CCCGGCTCCGACCGGCGCTCCGGCCCCCTCTCGCCCCCGCACCCGTCCTCTCTCGACATCCCGAAGCGATACGGA
GGCGGCGCCGTCTTCGACATGTACTCCCTCACCTACGTCTCCGATCCCGACCCCAGCCTCCTGTGCCCCATCTGC
CACGATCCGCTCGTCGATCCCGTCACGACGCCCTGCGACCATACCTTTTGCTACCGCTGCCTACGCCGCAGCATC
GCCTCGAGCCCGTCCGGCACCACCTGTCCCATCGACAGGGACCTTCTTGCCTGGCTCGACTGCTTCACCGCCGCC
AGGCTGATCCGCACCCAGCTCAATAGCCTCGTCGTCAAGTGCCCCCACCACGGCCGCGGCTGCGGCCGCGAGCTC
AAGCGCGAGGTCGTCGAGAGGCACGCGACGGCCGAATGCCGGTACCGAGACTTCTCCTGTCCCGATCTCGGCTGC
GACAAGAAGCTGCGCTGCAAGCCCAAGGACGACGCCTGCCCCCACACGGAGACGGGCTGCCCGCACTGCGACGCC
AGGACGGACGAGGCCGACCTCGAGCTGCACCTGCTGTCGTGCCCCCGAGCCAAGACCCGCTGCCAGGGCTGCTGG
CAGCTGATCTATCGCGCCCAGCTCGACGCCCACCACCAGCTCGAGTGTGACGGCGTCGAGACGCCGTGTCCCTAT
CAGGACGTCGGCTGCTCCGTGCGGGCCATGCGCGGCGAGATGAGCACCCACTCCCGCCTGTGTTCCTTCCACCCG
GACACGCCCTCGGGCATCGTCGTCCGGGCGCAGCGGGAGCTGATCCAGTCGTACGGCGACCTCGGGAGCCAGGTC
CGCGACATGAAGGCGCGCCAGGCCGAGACGGACCGCCGCCTCGAGGAGCTGACGGCGGCGCGCCGCGGTGACGGC
GCCGGCGACCCCATCGTCAACGACAACCGCACCATGCAGGACCTGGACGCCGGCTTCGAAGAGGTGCACCAGAAC
CTGACGCAGCTCGAGGCGCGGCAGAGCATGTGGACGATGAACCAGGTGATGCCGATCCGGGAAGAGGTGACGGAG
CTCCGGAACAACATCAACATGATCCGGATGCACGTCAACTGGCTGCTCAACAGGAGCCGCGAGGAGGGCCGCATC
AGGGCGGCCAACAATACGGGCGCCTCGGCCACGATCCGGCGCGACAGCTCGGGTGAGGCTGCCCCCGCGCTGCCC
GAGAGGAGGCGCTCATCGGGAACGGAGATGGACCTGCCGCGGCTGTGA
Gene >Hirsu2|4725
ATGTCGGCGCCCCAACAGCAGCCGAGCCCGGCAGCGGAAGCCGGGGGCGACGCCGCCGCCGACGCCGCCGCCGCC
ACCCCCCGAAACCGGGCGGCGCTGCGCAGCGCCAGCGTCGCCGTCAGCCTGTTGCGCGAGTCGCCGTCCGAGTCG
AGCGACGAGGGGCTGCGCATGAGCCCTGCAGCCGCCCGGCGCTTCGCCCGACGCAACCTGCGCCGCACCTCGGCC
ACCCCCGACCTCGTCACCAGCCTCGTCCGCCCGCCCTCGCCCGACGCCGTCTATGTCGCTCCCGGGGTCCAGGCC
CGCCTCCGGCCCGGCGGGCCTTCGCCGAGGGCCACCGCCACCGCCTCCGACCTGCTGCTCCTCCGCCCGGCCATC
CCCGGCTCCGACCGGCGCTCCGGCCCCCTCTCGCCCCCGCACCCGTCCTCTCTCGACATCCCGAAGCGATACGGA
GGCGGCGCCGTCTTCGACATGTACTCCCTCACCTACGTCTCCGATCCCGACCCCAGCCTCCTGTGCCCCATCTGC
CACGATCCGCTCGTCGATCCCGTCACGACGCCCTGCGACCATACCTTTTGCTACCGCTGCCTACGCCGCAGCATC
GCCTCGAGCCCGTCCGGCACCACCTGTCCCATCGACAGGGACCTTCTTGCCTGGCTCGACTGCTTCACCGCCGCC
AGGCTGATCCGCACCCAGCTCAATAGCCTCGTCGTCAAGTGCCCCCACCACGGCCGCGGCTGCGGCCGCGAGCTC
AAGCGCGAGGTCGTCGAGAGGCACGCGACGGCCGAATGCCGGTACCGAGACTTCTCCTGTCCCGATCTCGGCTGC
GACAAGAAGCTGCGCTGCAAGCCCAAGGACGACGCCTGCCCCCACACGGAGACGGGCTGCCCGCACTGCGACGCC
AGGACGGACGAGGCCGACCTCGAGCTGCACCTGCTGTCGTGCCCCCGAGCCAAGACCCGCTGCCAGGGCTGCTGG
CAGCTGATCTATCGCGCCCAGCTCGACGCCCACCACCAGCTCGAGTGTGACGGCGTCGAGACGCCGTGTCCCTAT
CAGGACGTCGGCTGCTCCGTGCGGGCCATGCGCGGCGAGATGAGCACCCACTCCCGCCTGTGTTCCTTCCACCCG
GACACGCCCTCGGGCATCGTCGTCCGGGCGCAGCGGGAGCTGATCCAGTCGTACGGCGACCTCGGGAGCCAGGTC
CGCGACATGAAGGCGCGCCAGGCCGAGACGGACCGCCGCCTCGAGGAGCTGACGGCGGCGCGCCGCGGTGACGGC
GCCGGCGACCCCATCGTCAACGACAACCGCACCATGCAGGACCTGGACGCCGGCTTCGAAGAGGTGCACCAGAAC
CTGACGCAGCTCGAGGCGCGGCAGAGCATGTGGACGATGAACCAGGTGATGCCGATCCGGGAAGAGGTGACGGAG
CTCCGGAACAACATCAACATGATCCGGATGCACGTCAACTGGCTGCTCAACAGGAGCCGCGAGGAGGGCCGCATC
AGGGCGGCCAACAATACGGGCGCCTCGGCCACGATCCGGCGCGACAGCTCGGGTGAGGCTGCCCCCGCGCTGCCC
GAGAGGAGGCGCTCATCGGGAACGGAGATGGACCTGCCGCGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail