Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4721
Gene name
LocationContig_239:16758..19023
Strand-
Gene length (bp)2265
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain 4.6E-68 67 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZPS3|DCE4_ARATH Glutamate decarboxylase 4 OS=Arabidopsis thaliana GN=GAD4 PE=1 SV=1 27 460 8.0E-159
sp|Q07346|DCE_PETHY Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1 27 472 1.0E-158
sp|Q42521|DCE1_ARATH Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2 32 462 4.0E-158
sp|Q9LSH2|DCE5_ARATH Glutamate decarboxylase 5 OS=Arabidopsis thaliana GN=GAD5 PE=2 SV=1 27 472 4.0E-155
sp|P54767|DCE_SOLLC Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1 42 468 9.0E-154
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZPS3|DCE4_ARATH Glutamate decarboxylase 4 OS=Arabidopsis thaliana GN=GAD4 PE=1 SV=1 27 460 8.0E-159
sp|Q07346|DCE_PETHY Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1 27 472 1.0E-158
sp|Q42521|DCE1_ARATH Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2 32 462 4.0E-158
sp|Q9LSH2|DCE5_ARATH Glutamate decarboxylase 5 OS=Arabidopsis thaliana GN=GAD5 PE=2 SV=1 27 472 4.0E-155
sp|P54767|DCE_SOLLC Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1 42 468 9.0E-154
sp|Q42472|DCE2_ARATH Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1 27 461 1.0E-153
sp|Q9ZPS4|DCE3_ARATH Glutamate decarboxylase 3 OS=Arabidopsis thaliana GN=GAD3 PE=2 SV=1 27 460 2.0E-151
sp|Q83PR1|DCEA_SHIFL Glutamate decarboxylase alpha OS=Shigella flexneri GN=gadA PE=3 SV=2 37 468 6.0E-125
sp|P69908|DCEA_ECOLI Glutamate decarboxylase alpha OS=Escherichia coli (strain K12) GN=gadA PE=1 SV=1 37 468 1.0E-123
sp|P69909|DCEA_ECOL6 Glutamate decarboxylase alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gadA PE=1 SV=1 37 468 1.0E-123
sp|P69912|DCEB_SHIFL Glutamate decarboxylase beta OS=Shigella flexneri GN=gadB PE=3 SV=1 40 468 2.0E-123
sp|P69910|DCEB_ECOLI Glutamate decarboxylase beta OS=Escherichia coli (strain K12) GN=gadB PE=1 SV=1 40 468 2.0E-123
sp|P69911|DCEB_ECO57 Glutamate decarboxylase beta OS=Escherichia coli O157:H7 GN=gadB PE=3 SV=1 40 468 2.0E-123
sp|Q8FHG5|DCEB_ECOL6 Glutamate decarboxylase beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gadB PE=3 SV=2 40 468 2.0E-123
sp|P58228|DCEA_ECO57 Glutamate decarboxylase alpha OS=Escherichia coli O157:H7 GN=gadA PE=3 SV=1 37 468 4.0E-123
sp|Q928R9|DCEB_LISIN Glutamate decarboxylase beta OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gadB PE=3 SV=1 27 470 1.0E-122
sp|Q9EYW9|DCEB_LISMO Glutamate decarboxylase beta OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gadB PE=3 SV=2 27 470 2.0E-121
sp|O30418|DCE_LACLM Glutamate decarboxylase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gadB PE=1 SV=2 36 470 2.0E-119
sp|Q9CG20|DCE_LACLA Glutamate decarboxylase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gadB PE=1 SV=1 36 470 3.0E-119
sp|Q928K4|DCEC_LISIN Probable glutamate decarboxylase gamma OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2528 PE=3 SV=1 35 460 1.0E-117
sp|Q9F5P3|DCEA_LISMO Glutamate decarboxylase alpha OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gadA PE=3 SV=2 41 461 6.0E-117
sp|Q8Y4K4|DCEC_LISMO Probable glutamate decarboxylase gamma OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2434 PE=3 SV=1 33 460 4.0E-116
sp|Q54VQ5|GADA_DICDI Glutamate decarboxylase A OS=Dictyostelium discoideum GN=gadA PE=2 SV=1 42 460 5.0E-107
sp|Q54IJ3|GADB_DICDI Glutamate decarboxylase B OS=Dictyostelium discoideum GN=gadB PE=2 SV=1 49 470 8.0E-105
sp|Q04792|DCE_YEAST Glutamate decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAD1 PE=1 SV=1 56 462 2.0E-103
sp|Q0W498|MFNA_METAR Probable L-tyrosine/L-aspartate decarboxylase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=mfnA PE=3 SV=1 102 465 1.0E-27
sp|Q12VA2|MFNA_METBU Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mfnA PE=3 SV=1 86 461 1.0E-25
sp|O28275|MFNA_ARCFU Probable L-aspartate decarboxylase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=mfnA PE=3 SV=1 95 462 1.0E-25
sp|Q46DU3|MFNA_METBF Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mfnA PE=3 SV=1 95 358 2.0E-25
sp|O58679|MFNA_PYRHO L-aspartate/L-glutamate decarboxylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=mfnA PE=1 SV=1 51 462 1.0E-24
sp|Q8TV92|MFNA_METKA Probable L-tyrosine/L-aspartate decarboxylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=mfnA PE=3 SV=1 107 360 3.0E-24
sp|Q8TUQ9|MFNA_METAC Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mfnA PE=3 SV=1 95 358 3.0E-24
sp|Q8PXA5|MFNA_METMA Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mfnA PE=3 SV=1 95 434 7.0E-24
sp|Q8U1P6|MFNA_PYRFU Probable L-aspartate decarboxylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=mfnA PE=3 SV=1 51 375 1.0E-23
sp|A2STQ3|MFNA_METLZ Probable L-tyrosine/L-aspartate decarboxylase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=mfnA PE=3 SV=1 105 380 1.0E-23
sp|A0B9M9|MFNA_METTP Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mfnA PE=3 SV=2 57 461 4.0E-23
sp|Q2NHY7|MFNA_METST Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=mfnA PE=3 SV=1 95 465 1.0E-22
sp|Q9V7Y2|SGPL_DROME Sphingosine-1-phosphate lyase OS=Drosophila melanogaster GN=Sply PE=2 SV=1 54 470 2.0E-22
sp|B8GDM7|MFNA_METPE Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=mfnA PE=3 SV=1 104 380 2.0E-22
sp|Q9UZD5|MFNA_PYRAB Probable L-aspartate decarboxylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mfnA PE=3 SV=1 55 375 4.0E-22
sp|Q5JJ82|MFNA_THEKO L-aspartate decarboxylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=mfnA PE=1 SV=1 71 375 5.0E-21
sp|C5A2X8|MFNA_THEGJ Probable L-aspartate decarboxylase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=mfnA PE=3 SV=1 71 375 6.0E-21
sp|A7IAB9|MFNA_METB6 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanoregula boonei (strain 6A8) GN=mfnA PE=3 SV=1 104 380 5.0E-20
sp|O27188|MFNA_METTH Probable L-tyrosine/L-aspartate decarboxylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=mfnA PE=3 SV=1 96 433 6.0E-20
sp|Q5V1B4|MFNA_HALMA Probable L-aspartate decarboxylase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mfnA PE=3 SV=1 104 461 1.0E-18
sp|A3CWM4|MFNA_METMJ Probable L-tyrosine/L-aspartate decarboxylase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=mfnA PE=3 SV=1 83 380 2.0E-18
sp|Q3IT46|MFNA_NATPD Probable L-aspartate decarboxylase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mfnA PE=3 SV=1 104 461 4.0E-18
sp|Q2FSD2|MFNA_METHJ Probable L-tyrosine/L-aspartate decarboxylase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=mfnA PE=3 SV=1 104 379 2.0E-17
sp|Q05567|SGPL_YEAST Sphingosine-1-phosphate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPL1 PE=1 SV=1 114 357 9.0E-16
sp|Q60358|MFNA_METJA L-tyrosine/L-aspartate decarboxylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnA PE=1 SV=1 120 458 8.0E-15
sp|A6URB4|MFNA_METVS Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=mfnA PE=3 SV=1 107 380 3.0E-14
sp|A5ULW4|MFNA_METS3 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=mfnA PE=3 SV=1 96 426 3.0E-14
sp|Q9HSA3|MFNA_HALSA Probable L-aspartate decarboxylase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mfnA PE=3 SV=1 104 358 8.0E-14
sp|B0R349|MFNA_HALS3 Probable L-aspartate decarboxylase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mfnA PE=3 SV=1 104 358 8.0E-14
sp|Q9C509|SGPL_ARATH Sphingosine-1-phosphate lyase OS=Arabidopsis thaliana GN=DPL1 PE=1 SV=1 118 424 1.0E-13
sp|Q9Y194|SGPL_CAEEL Sphingosine-1-phosphate lyase OS=Caenorhabditis elegans GN=spl-1 PE=1 SV=1 114 424 2.0E-13
sp|Q54RV9|SGPL_DICDI Sphingosine-1-phosphate lyase OS=Dictyostelium discoideum GN=sglA PE=2 SV=1 93 375 2.0E-13
sp|Q52RG7|SGPL_ORYSJ Sphingosine-1-phosphate lyase OS=Oryza sativa subsp. japonica GN=SPL PE=2 SV=2 107 457 1.0E-12
sp|Q8R0X7|SGPL1_MOUSE Sphingosine-1-phosphate lyase 1 OS=Mus musculus GN=Sgpl1 PE=1 SV=1 56 435 4.0E-12
sp|O95470|SGPL1_HUMAN Sphingosine-1-phosphate lyase 1 OS=Homo sapiens GN=SGPL1 PE=1 SV=3 96 433 2.0E-11
sp|Q8CHN6|SGPL1_RAT Sphingosine-1-phosphate lyase 1 OS=Rattus norvegicus GN=Sgpl1 PE=2 SV=1 114 435 3.0E-11
sp|Q5R4G0|SGPL1_PONAB Sphingosine-1-phosphate lyase 1 OS=Pongo abelii GN=SGPL1 PE=2 SV=1 96 433 1.0E-10
sp|A6VIC0|MFNA_METM7 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=mfnA PE=3 SV=1 114 426 2.0E-10
sp|A6UVR4|MFNA_META3 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=mfnA PE=3 SV=1 117 445 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016831 carboxy-lyase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0006082 organic acid metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0070279 vitamin B6 binding No
GO:0019842 vitamin binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4721
MVHLTAVHHSDDSGHEAASSQPATASLLRLSSEADSFATSVYGSRFAGEDLPRDRMPEDQMPPAVAYRMIKDDLS
LDNNPRLNLASFVTTYMEDEAERLMTEAMAKNFIDYEQYPQSADIQARCVNMIGDLFHAPSGSAVGTSAVGSSEA
IMLAVLAMKRRWAAARRAAGKSADAPNLVMSSAVQVCWEKATRYFEIEERFVFCAPDRFVVDPGLMVDLCDENTI
GCVLILGTTYTGHYEDVAAVSDLLLARGVDVPIHVDAASGGFVAPFVVPDLAWDFRCEKVVSINVSGHKYGLVYP
GIGWVVWRAPEFLPRELVFNIDYLGAQQSSFTLNFSKGASGVIGQYYQLVRLGRRGYRAIMSNLVRTADYLADAL
AGQGFVIMSERGGGGGVPLVAFRFADDDDDAARYYDEFDLAHQLRSRGWVVPAYTMAPRTDGLKMLRVVVREDFS
RGLCDTLIADVRLCVGVLQQTDRDTLKRQRDYVRTHLVAAARHRHARHHPHHYKNEKHSLQGTTGKTHAAC*
Coding >Hirsu2|4721
ATGGTCCACCTCACAGCCGTCCACCACAGCGACGACTCGGGCCACGAGGCCGCAAGCAGCCAGCCAGCGACAGCG
AGCCTGCTGCGGCTATCGAGCGAGGCCGACTCGTTCGCGACGAGCGTGTACGGCTCGCGCTTCGCGGGCGAGGAC
CTGCCGCGCGACCGCATGCCCGAGGACCAGATGCCGCCGGCCGTCGCCTACCGCATGATCAAGGACGACCTCAGC
CTCGACAACAACCCGCGCCTCAACCTCGCCTCCTTCGTCACGACATACATGGAAGACGAGGCGGAGCGGCTGATG
ACGGAGGCCATGGCCAAGAACTTCATCGACTACGAGCAGTACCCGCAGTCGGCCGACATCCAGGCCCGCTGCGTC
AACATGATCGGCGACCTGTTCCACGCGCCCAGCGGCAGCGCCGTCGGCACCTCGGCCGTCGGCTCCTCCGAGGCC
ATCATGCTGGCCGTGCTGGCCATGAAGCGGCGCTGGGCGGCGGCGCGGCGGGCCGCCGGTAAGTCGGCCGACGCG
CCCAACCTCGTCATGTCGTCGGCCGTCCAGGTCTGCTGGGAGAAGGCGACGCGCTACTTTGAGATCGAGGAGCGC
TTCGTCTTCTGTGCGCCCGACCGCTTTGTCGTCGACCCGGGCTTGATGGTTGACCTCTGTGACGAGAACACCATC
GGCTGCGTGCTCATTCTCGGCACTACCTATACCGGCCACTACGAGGATGTGGCGGCCGTGAGCGACCTGTTGCTG
GCTCGCGGCGTTGATGTGCCGATCCATGTTGATGCTGCGAGCGGCGGGTTTGTTGCCCCCTTTGTTGTGCCGGAC
CTTGCGTGGGACTTTCGCTGCGAGAAGGTGGTGTCGATTAACGTGTCTGGTCACAAGTACGGCCTCGTCTACCCC
GGCATCGGCTGGGTCGTGTGGCGCGCGCCCGAGTTCCTGCCGCGCGAGCTCGTCTTCAACATCGACTACCTGGGC
GCGCAGCAGTCGTCCTTCACCCTCAACTTCTCCAAGGGCGCCTCGGGCGTCATCGGCCAGTACTACCAGCTGGTC
CGGCTCGGCCGGCGCGGCTACCGCGCCATCATGAGCAACCTGGTCCGCACGGCCGACTACCTGGCCGACGCGCTG
GCCGGGCAGGGCTTCGTCATCATGTCGGAGCGCGGCGGCGGCGGCGGCGTGCCGCTCGTGGCCTTCCGCTTCGCC
GACGACGACGACGACGCGGCCCGCTACTACGACGAGTTCGACCTGGCCCACCAGCTGCGCTCGCGAGGCTGGGTC
GTGCCGGCCTACACCATGGCGCCCCGGACCGACGGGCTCAAGATGCTGCGCGTCGTCGTCCGCGAGGACTTCTCG
CGCGGCCTGTGCGACACCCTCATCGCCGACGTCCGCCTCTGCGTCGGCGTCCTGCAGCAGACGGACCGCGACACG
CTCAAGCGCCAGCGCGACTACGTCCGCACCCACCTCGTCGCCGCCGCCCGCCACCGCCACGCCCGCCACCACCCG
CACCACTACAAGAACGAAAAGCATTCGCTGCAGGGGACGACGGGCAAGACCCATGCTGCTTGCTGA
Transcript >Hirsu2|4721
ATGGTCCACCTCACAGCCGTCCACCACAGCGACGACTCGGGCCACGAGGCCGCAAGCAGCCAGCCAGCGACAGCG
AGCCTGCTGCGGCTATCGAGCGAGGCCGACTCGTTCGCGACGAGCGTGTACGGCTCGCGCTTCGCGGGCGAGGAC
CTGCCGCGCGACCGCATGCCCGAGGACCAGATGCCGCCGGCCGTCGCCTACCGCATGATCAAGGACGACCTCAGC
CTCGACAACAACCCGCGCCTCAACCTCGCCTCCTTCGTCACGACATACATGGAAGACGAGGCGGAGCGGCTGATG
ACGGAGGCCATGGCCAAGAACTTCATCGACTACGAGCAGTACCCGCAGTCGGCCGACATCCAGGCCCGCTGCGTC
AACATGATCGGCGACCTGTTCCACGCGCCCAGCGGCAGCGCCGTCGGCACCTCGGCCGTCGGCTCCTCCGAGGCC
ATCATGCTGGCCGTGCTGGCCATGAAGCGGCGCTGGGCGGCGGCGCGGCGGGCCGCCGGTAAGTCGGCCGACGCG
CCCAACCTCGTCATGTCGTCGGCCGTCCAGGTCTGCTGGGAGAAGGCGACGCGCTACTTTGAGATCGAGGAGCGC
TTCGTCTTCTGTGCGCCCGACCGCTTTGTCGTCGACCCGGGCTTGATGGTTGACCTCTGTGACGAGAACACCATC
GGCTGCGTGCTCATTCTCGGCACTACCTATACCGGCCACTACGAGGATGTGGCGGCCGTGAGCGACCTGTTGCTG
GCTCGCGGCGTTGATGTGCCGATCCATGTTGATGCTGCGAGCGGCGGGTTTGTTGCCCCCTTTGTTGTGCCGGAC
CTTGCGTGGGACTTTCGCTGCGAGAAGGTGGTGTCGATTAACGTGTCTGGTCACAAGTACGGCCTCGTCTACCCC
GGCATCGGCTGGGTCGTGTGGCGCGCGCCCGAGTTCCTGCCGCGCGAGCTCGTCTTCAACATCGACTACCTGGGC
GCGCAGCAGTCGTCCTTCACCCTCAACTTCTCCAAGGGCGCCTCGGGCGTCATCGGCCAGTACTACCAGCTGGTC
CGGCTCGGCCGGCGCGGCTACCGCGCCATCATGAGCAACCTGGTCCGCACGGCCGACTACCTGGCCGACGCGCTG
GCCGGGCAGGGCTTCGTCATCATGTCGGAGCGCGGCGGCGGCGGCGGCGTGCCGCTCGTGGCCTTCCGCTTCGCC
GACGACGACGACGACGCGGCCCGCTACTACGACGAGTTCGACCTGGCCCACCAGCTGCGCTCGCGAGGCTGGGTC
GTGCCGGCCTACACCATGGCGCCCCGGACCGACGGGCTCAAGATGCTGCGCGTCGTCGTCCGCGAGGACTTCTCG
CGCGGCCTGTGCGACACCCTCATCGCCGACGTCCGCCTCTGCGTCGGCGTCCTGCAGCAGACGGACCGCGACACG
CTCAAGCGCCAGCGCGACTACGTCCGCACCCACCTCGTCGCCGCCGCCCGCCACCGCCACGCCCGCCACCACCCG
CACCACTACAAGAACGAAAAGCATTCGCTGCAGGGGACGACGGGCAAGACCCATGCTGCTTGCTGA
Gene >Hirsu2|4721
ATGGTCCACCTCACAGCCGTCCACCACAGCGACGACTCGGGCCACGAGGCCGCAAGCAGCCAGCCAGCGACAGCG
AGCCTGCTGCGGCTATCGAGCGAGGCCGACTCGTTCGCGACGAGCGTGTACGGCTCGCGCTTCGCGGGCGAGGAC
CTGCCGCGCGACCGCATGCCCGAGGACCAGATGCCGCCGGCCGTCGCCTACCGCATGATCAAGGACGACCTCAGC
CTCGACAACAACCCGCGCCTCAAGTAAGTGGGCGCCCCGTCCGGCGACGCGCGAGCGGCGTGGGGAGGGAACTTG
GTCCAGGGGGGGGGGGCGCTGACGTTGCGCGCCGCAGCCTCGCCTCCTTCGTCACGACATACATGGTTCGCTTCC
CTCCCCCCCCCCCCCCCCCCGTCGGCGAGAAGGCTAGCCAGGCGCTGACGCGAGAGCTCGAAAAAGGAAGACGAG
GCGGAGCGGCTGATGACGGAGGCCATGGCCAAGAACTTCATCGACTACGAGCAGTACCCGCAGTCGGCCGACATC
CAGGCCCGCTGCGTCAACATGATCGGCGACCTGTTCCACGCGCCCAGCGGCAGCGCCGTCGGCACCTCGGCCGTC
GGCTCCTCCGAGGCCATCATGCTGGCCGTGCTGGCCATGAAGCGGCGCTGGGCGGCGGCGCGGCGGGCCGCCGGT
AAGTCGGCCGACGCGCCCAACCTCGTCATGTCGTCGGCCGTCCAGGTCTGCTGGGAGAAGGCGACGCGCTACTTT
GAGATCGAGGAGCGCTTCGTCTTCTGTGCGCCCGACCGCTTTGTCGTCGACCCGGGCTTGATGGTTGACCTCTGT
GACGAGAACACCATCGGCTGCGTGCTCATTCTCGGCACTACCTATACCGGCCACTACGAGGATGTGGCGGCCGTG
AGCGACCTGTTGCTGGCTCGCGGCGTTGATGTGCCGATCCATGTTGATGCTGCGAGCGGCGGGTTTGTTGCCCCC
TTTGTTGTGCCGGACCTTGCGTGGGACTTTCGCTGCGAGAAGGTGGTGTCGATTAACGTGTCTGGTCACAAGGCA
AGGATGCTCTCTTCTCTTTTACGTTGTTCGTCTTCTCTATTCCTCTTCCTCTTTCCCCTTTTCTCCATCTTCTCC
TTGATCGTTATTATTATCACCTTCTCATTCTCCGTATCGTTCTTTCCTCTATCTCCTCTACTAAGGATACTCTTT
TCTTTATTACTTTCTCCGTCTTCTCTATTCCTCTTCCTCTTTTCCCTTTTCTCCATCTTCTCCTTGATCGTTATT
ATTATCACTTTTTCTTTCTTCGTATCCTTCCCTCTGTCTCCTCCACCAAGGACGCTCTCTTCTCTTTTATATTGT
TCGTCTTCTCTATTCCTCTTACTCCTTTCCTTTTCTCCTTGTCCTGTATCGTTATCATCATCATCACCTTCTCCT
TCTTCTTTCCTCCCCCCCTTTTTATCCTTGTCCTGAATCAATATCAACATCATCACCATCGTCTTCTTGATAATA
ACCTCCACCAGTACGGCCTCGTCTACCCCGGCATCGGCTGGGTCGTGTGGCGCGCGCCCGAGTTCCTGCCGCGCG
AGCTCGTCTTCAACATCGACTACCTGGGCGCGCAGCAGTCGTCCTTCACCCTCAACTTCTCCAAGGGCGCCTCGG
GCGTCATCGGCCAGTACTACCAGCTGGTCCGGCTCGGCCGGCGCGGCTACCGCGCCATCATGAGCAACCTGGTCC
GCACGGCCGACTACCTGGCCGACGCGCTGGCCGGGCAGGGCTTCGTCATCATGTCGGAGCGCGGCGGCGGCGGCG
GCGTGCCGCTCGTGGCCTTCCGCTTCGCCGACGACGACGACGACGCGGCCCGCTACTACGACGAGTTCGACCTGG
CCCACCAGCTGCGCTCGCGAGGCTGGGTCGTGCCGGCCTACACCATGGCGCCCCGGACCGACGGGCTCAAGATGC
TGCGCGTCGTCGTCCGCGAGGACTTCTCGCGCGGCCTGTGCGACACCCTCATCGCCGACGTCCGCCTCTGCGTCG
GCGTCCTGCAGCAGACGGACCGCGACACGCTCAAGCGCCAGCGCGACTACGTCCGCACCCACCTCGTCGCCGCCG
CCCGCCACCGCCACGCCCGCCACCACCCGCACCACTACAAGGTCTGTCGCCGCGCCCCCCCTCGTCTTTCGCCCG
TGTGCGGGACGGAGGACTTGCTGACGGCCTCGCCAGAACGAAAAGCATTCGCTGCAGGGGACGACGGGCAAGACC
CATGCTGCTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail