Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4718
Gene name
LocationContig_239:10806..12000
Strand+
Gene length (bp)1194
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09451 ATG27 Autophagy-related protein 27 2.8E-95 16 351

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B086|ATG27_ARTBC Autophagy-related protein 27 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01857 PE=1 SV=1 6 339 7.0E-25
sp|Q6CBS9|ATG27_YARLI Autophagy-related protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG27 PE=3 SV=1 245 355 5.0E-23
sp|A7KAK7|ATG27_PICAN Autophagy-related protein 27 OS=Pichia angusta GN=ATG27 PE=3 SV=1 240 355 8.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 284 306 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4718
MYPPQLSSVAVAVAVALAPLRTSAMLRCENVRVDGHSYDLSQLSGPRSVVTSLYESIPDVYHNTTYTVDICKPLK
KSGKAKKTEECPNGTRVCAIKRFLQGQTNAVEQVVAIAGSLENAGGSQFDYDAVRLKTSDSNSDSQKEGLRLVLK
GGKHPLDGPVAERREQRAVIEFLCDHNKKGDEGEWEAEDKYDKEGGPQRRADDKGGDGKDDGGNGTSAIEHQLRK
PDAALIWESYEREKDADVLRLTWHTKFACETQSGGGGGGGDGGDGGNKGDGNSSRHWGFFTWFVLVLFLGIAAYL
IFGSWLNYNRYGARGWDLVPHGDMIRDVPYLMKDWVRRVLNTVQGTGSRGGYSAV*
Coding >Hirsu2|4718
ATGTATCCGCCTCAATTATCAAGCGTCGCCGTCGCCGTCGCCGTCGCCCTCGCGCCGCTGCGGACGTCGGCGATG
CTGCGATGCGAGAACGTGCGAGTCGACGGCCACAGCTACGACCTCTCCCAGCTGTCGGGCCCGCGGTCCGTCGTG
ACGTCTCTGTACGAGTCGATCCCCGACGTGTACCACAACACGACCTACACCGTGGACATCTGCAAGCCGCTGAAG
AAGAGCGGCAAGGCGAAGAAGACGGAGGAGTGTCCCAACGGGACCCGAGTCTGTGCCATCAAGCGCTTCCTCCAG
GGCCAGACGAACGCAGTCGAGCAGGTGGTGGCCATCGCCGGATCTCTGGAGAACGCGGGCGGGTCGCAATTCGAC
TACGATGCCGTGCGGTTGAAGACGAGCGACTCCAACAGCGACTCCCAGAAGGAGGGCTTGAGGCTCGTGCTCAAG
GGCGGCAAGCACCCCCTGGACGGCCCGGTCGCCGAGCGACGCGAGCAGAGGGCCGTCATCGAGTTTCTCTGCGAT
CACAACAAGAAGGGTGACGAGGGCGAGTGGGAGGCCGAGGACAAGTACGACAAGGAGGGCGGGCCGCAGCGGCGA
GCCGACGACAAGGGGGGCGACGGCAAGGACGACGGCGGCAACGGCACGTCCGCCATCGAACATCAGCTCCGGAAG
CCCGACGCGGCTCTCATATGGGAGAGCTACGAGCGGGAGAAGGATGCCGACGTGCTGCGCCTGACCTGGCACACC
AAGTTCGCCTGCGAGACGCAGAGCGGCGGCGGCGGCGGCGGCGGCGACGGCGGCGACGGCGGCAACAAGGGCGAC
GGCAACAGCAGCCGCCACTGGGGCTTCTTCACCTGGTTTGTCCTTGTCCTCTTCCTCGGCATCGCCGCCTACCTC
ATCTTCGGCTCTTGGCTCAACTATAACCGGTACGGAGCTAGAGGCTGGGACCTGGTTCCGCACGGCGACATGATC
CGCGACGTCCCCTACCTGATGAAAGACTGGGTGAGAAGGGTGCTCAACACCGTCCAAGGAACGGGCAGCAGGGGA
GGGTACAGCGCAGTCTAA
Transcript >Hirsu2|4718
ATGTATCCGCCTCAATTATCAAGCGTCGCCGTCGCCGTCGCCGTCGCCCTCGCGCCGCTGCGGACGTCGGCGATG
CTGCGATGCGAGAACGTGCGAGTCGACGGCCACAGCTACGACCTCTCCCAGCTGTCGGGCCCGCGGTCCGTCGTG
ACGTCTCTGTACGAGTCGATCCCCGACGTGTACCACAACACGACCTACACCGTGGACATCTGCAAGCCGCTGAAG
AAGAGCGGCAAGGCGAAGAAGACGGAGGAGTGTCCCAACGGGACCCGAGTCTGTGCCATCAAGCGCTTCCTCCAG
GGCCAGACGAACGCAGTCGAGCAGGTGGTGGCCATCGCCGGATCTCTGGAGAACGCGGGCGGGTCGCAATTCGAC
TACGATGCCGTGCGGTTGAAGACGAGCGACTCCAACAGCGACTCCCAGAAGGAGGGCTTGAGGCTCGTGCTCAAG
GGCGGCAAGCACCCCCTGGACGGCCCGGTCGCCGAGCGACGCGAGCAGAGGGCCGTCATCGAGTTTCTCTGCGAT
CACAACAAGAAGGGTGACGAGGGCGAGTGGGAGGCCGAGGACAAGTACGACAAGGAGGGCGGGCCGCAGCGGCGA
GCCGACGACAAGGGGGGCGACGGCAAGGACGACGGCGGCAACGGCACGTCCGCCATCGAACATCAGCTCCGGAAG
CCCGACGCGGCTCTCATATGGGAGAGCTACGAGCGGGAGAAGGATGCCGACGTGCTGCGCCTGACCTGGCACACC
AAGTTCGCCTGCGAGACGCAGAGCGGCGGCGGCGGCGGCGGCGGCGACGGCGGCGACGGCGGCAACAAGGGCGAC
GGCAACAGCAGCCGCCACTGGGGCTTCTTCACCTGGTTTGTCCTTGTCCTCTTCCTCGGCATCGCCGCCTACCTC
ATCTTCGGCTCTTGGCTCAACTATAACCGGTACGGAGCTAGAGGCTGGGACCTGGTTCCGCACGGCGACATGATC
CGCGACGTCCCCTACCTGATGAAAGACTGGGTGAGAAGGGTGCTCAACACCGTCCAAGGAACGGGCAGCAGGGGA
GGGTACAGCGCAGTCTAA
Gene >Hirsu2|4718
ATGTATCCGCCTCAATTATCAAGCGTCGCCGTCGCCGTCGCCGTCGCCCTCGCGCCGCTGCGGACGTCGGCGATG
CTGCGATGCGAGAACGTGCGAGTCGACGGCCACAGCTACGACCTCTCCCAGCTGTCGGGCCCGCGGTCCGTCGTG
ACGTCTCTGTACGAGTCGATCCCCGACGTGTACCACAACACGACCTACACCGTGGACATCTGCAAGCCGCTGAAG
AAGAGCGGCAAGGCGAAGAAGACGGAGGAGTGTCCCAACGGGACCCGAGGTGAGCCTCCTCCGCCTCCTCGTCCG
GGCGCGCGCTGACGCCGTGCGTCAACCAGTCTGTGCCATCAAGCGCTTCCTCCAGGGCCAGACGAACGCAGTCGA
GCAGGTGGTGGCCATCGCCGGATCTCTGGAGAACGCGGGCGGGTCGCAATTCGACTACGATGCCGTGCGGTTGAA
GACGAGCGACTCCAACAGCGACTCCCAGAAGGAGGGCTTGAGGCTCGTGCTCAAGGGCGGCAAGCACCCCCTGGA
CGGCCCGGTCGCCGAGCGACGCGAGCAGAGGGCCGTCATCGAGTTTCTCTGCGATCACAACAAGAAGGGTGACGA
GGGCGAGTGGGAGGCCGAGGACAAGTACGACAAGGAGGGCGGGCCGCAGCGGCGAGCCGACGACAAGGGGGGCGA
CGGCAAGGACGACGGCGGCAACGGCACGTCCGCCATCGAACATCAGCTCCGGAAGCCCGACGCGGCTCTCATATG
GGAGAGCTACGAGCGGGAGAAGGATGCCGACGTGCTGCGCCTGACCTGGCACACCAAGTTCGCCTGCGAGACGCA
GAGCGGCGGCGGCGGCGGCGGCGGCGACGGCGGCGACGGCGGCAACAAGGGCGACGGCAACAGCAGCCGCCACTG
GGGCTTCTTCACCTGGTTTGTCCTTGTGTACGCTCGCGCCCGCCCTGTCCCTGGCCAAGGGTTGTGTCGAGGGCT
GTGCTGACTTGTGCTTCCCGCAGCCTCTTCCTCGGCATCGCCGCCTACCTCATCTTCGGCTCTTGGCTCAACTAT
AACCGGTACGGAGCTAGAGGCTGGGACCTGGTTCCGCACGGCGACATGATCCGCGACGTCCCCTACCTGATGAAA
GACTGGGTGAGAAGGGTGCTCAACACCGTCCAAGGAACGGGCAGCAGGGGAGGGTACAGCGCAGTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail