Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4717
Gene name
LocationContig_239:6405..9902
Strand+
Gene length (bp)3497
Transcript length (bp)3414
Coding sequence length (bp)3414
Protein length (aa) 1138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12090 Spt20 Spt20 family 6.2E-48 116 383

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14174|SPT20_SCHPO SAGA complex subunit spt20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt20 PE=1 SV=1 120 207 1.0E-17
sp|Q5A2B9|SPT20_CANAL Transcription factor SPT20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT20 PE=1 SV=1 117 224 1.0E-08
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 548 1023 6.0E-07
sp|Q5DTW2|SMBT2_MOUSE Scm-like with four MBT domains protein 2 OS=Mus musculus GN=Sfmbt2 PE=1 SV=2 613 665 1.0E-06
sp|B3A0R7|MRP_LOTGI Methionine-rich protein OS=Lottia gigantea PE=1 SV=1 598 668 8.0E-06

GO

GO Term Description Terminal node
GO:0000124 SAGA complex Yes
GO:0003712 transcription coregulator activity Yes
GO:0044464 cell part No
GO:0031248 protein acetyltransferase complex No
GO:1902494 catalytic complex No
GO:0044428 nuclear part No
GO:1905368 peptidase complex No
GO:0140110 transcription regulator activity No
GO:0003674 molecular_function No
GO:0044424 intracellular part No
GO:1990234 transferase complex No
GO:0032991 protein-containing complex No
GO:0044446 intracellular organelle part No
GO:0070461 SAGA-type complex No
GO:0000123 histone acetyltransferase complex No
GO:0044422 organelle part No
GO:1902493 acetyltransferase complex No
GO:0044451 nucleoplasm part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4717
MAPSSPVVQQNGATKIKRPVPPGIQTNGAAPSTSSPSPSMSAKKPPPSAKLPPNSAGDRTITASTVRPVNRARRE
PSSQAPGRNSRNSTGIRSASFCVDMPVQDAEPLPYVVPDSYILKKFAGRPPSLVVHVHPTHFRFDGQDGMFQYKS
PMRTFIEHLRTRTIPHDLLEYFNQANVPFYDGRLIVQIHDHKTVAQAKDAAKPSPKSSSNAVVPSSIHNYNQCLT
PSPYIPFPKEDQATAEEPVREEAEVKKEESGKEGEKAPQDGSKTKTPSKPRTFTVVLHPTQESLQVDLRLKAMTP
RGSSDARGEVVTMAQPSTPISLVPPTPTAANMPPPATRPAKRQLMELDAANIYAAEGQILLATTPRLMLKPTRDA
EETIALLEAMGHPKHSEPPPQPKTRKRTVAEMAADEAAAAEQERYMLLLDDRLSSGLTGAQGSGGADGDAQTGAA
TFEPRFERFKLLDDLCREQAEKKEQERIKQQENDRRMQLQRQQEAVQRQQAEAEKARRDAAAARENQLRQAEAQR
QQAMTARAGSNAPAPPSNMNSGNGNNTNAASNSINNAAGGTAGGNNNGTNNGQGPSQSQHAHPIQSGSVAAAMPS
SVAGPVHNAMPNAMPNGMPNGMPNGMPNGMSSGMPNGMPNGMPNGVPNGMPNGMPNGMPSGLPNGMPNGMPNQAQ
QRFQAQMSQPPASSPVVRQATPAQQHMSSPMVGSVPMQQTNSSMAASPSRPSSVVQNAQVPAPMAHNMSARGSQQ
SHPSGTPRMPHSTPNMAHGTPINRPAMSATPRMSQASPPPNMMAQNSQMGPGPAMMMNNQGMNQHNPQVFALAAQ
QRAIAQQQQQQQQHQQQIAAMQNGANMGLNGQGISQAQQQQMMQAMQRQMLLQHQQQQQQQQQQQQQQQHPQQPQ
QHQQGGMMSAQQQQQFVQYAQQLQNMQGNHLRQMSPQMQAQLQQMVRMGQLGNPMQRQVSGQMMNGGNANMQALA
AMQMQQQHQQQHQQQQHQQQPQPQPQPPQQQQQPQQHHQPQQQHQPQQPGQPSQAGANPIQVQIQNNARQIYGRL
VQSAISKYGAPENIPPDIIEKMKQTAMAQSQHLLQQTMAQRRMHQQQMLLQQQQQHQQQQQQQQPQQQQQQQNGM
QGMNGMMGHQGM*
Coding >Hirsu2|4717
ATGGCGCCCAGCAGCCCCGTCGTCCAGCAGAATGGCGCGACCAAGATCAAGCGCCCCGTCCCGCCAGGCATCCAG
ACCAACGGGGCCGCGCCGTCGACGTCGTCGCCCTCGCCGTCCATGTCCGCCAAGAAGCCGCCGCCGAGCGCGAAG
CTGCCCCCGAACTCGGCCGGCGACCGCACCATCACCGCCTCCACCGTCCGTCCCGTCAACCGAGCTCGCCGCGAG
CCGTCGTCCCAGGCGCCCGGCAGGAACTCACGGAACAGCACCGGCATCCGCTCCGCCTCCTTCTGCGTCGACATG
CCTGTCCAGGATGCAGAACCCTTACCATACGTTGTCCCCGACTCCTACATCCTCAAGAAGTTCGCCGGCCGCCCC
CCGTCACTCGTCGTACACGTGCACCCGACGCACTTTCGCTTCGATGGCCAGGATGGCATGTTCCAGTACAAGTCG
CCCATGCGCACATTCATCGAGCATTTGCGAACCCGCACGATCCCGCACGACCTCCTCGAGTACTTCAACCAGGCC
AACGTGCCCTTCTACGATGGGCGCCTCATCGTCCAAATCCATGATCACAAGACCGTCGCCCAGGCCAAAGACGCC
GCGAAGCCATCTCCCAAATCCTCATCGAACGCAGTCGTGCCGTCATCTATCCACAACTACAACCAGTGTCTGACG
CCGTCGCCCTACATCCCGTTCCCAAAGGAGGACCAGGCAACCGCCGAGGAGCCCGTCAGGGAAGAGGCAGAAGTG
AAGAAGGAGGAAAGCGGCAAGGAGGGTGAGAAGGCGCCACAGGATGGTTCGAAGACTAAAACGCCCTCGAAGCCC
AGGACATTCACTGTCGTCCTGCACCCCACACAAGAGAGTTTGCAAGTCGACTTGCGACTCAAGGCCATGACCCCC
AGAGGATCGAGCGACGCACGTGGCGAGGTGGTGACCATGGCCCAGCCGTCGACACCCATATCTCTCGTCCCCCCG
ACTCCCACCGCCGCCAACATGCCACCTCCCGCAACACGTCCCGCCAAGAGGCAGCTGATGGAACTGGACGCGGCC
AACATCTACGCCGCCGAGGGGCAGATTCTACTGGCCACCACCCCGCGACTGATGCTGAAGCCGACCAGGGACGCT
GAGGAAACCATCGCGCTCCTGGAGGCCATGGGTCATCCCAAACACTCCGAGCCGCCACCGCAGCCCAAGACGAGA
AAGAGAACGGTGGCCGAGATGGCTGCCGACGAGGCTGCCGCCGCCGAGCAGGAACGCTACATGCTCCTCCTGGAC
GACCGGCTTTCTTCGGGCCTGACCGGTGCCCAGGGCTCAGGGGGTGCCGACGGAGATGCGCAGACCGGCGCTGCC
ACCTTCGAGCCCAGGTTTGAGCGATTCAAGCTCCTCGACGACCTTTGCAGAGAACAGGCGGAGAAGAAGGAGCAG
GAGCGGATCAAGCAGCAAGAGAACGACCGGAGGATGCAGCTTCAGAGACAACAGGAGGCCGTGCAGCGGCAGCAG
GCAGAAGCGGAAAAGGCCCGGCGAGACGCTGCCGCGGCGAGGGAGAACCAGCTGCGGCAGGCAGAGGCGCAGCGT
CAGCAGGCCATGACGGCCCGCGCAGGTTCTAATGCCCCGGCGCCCCCGAGTAACATGAACAGCGGTAACGGCAAC
AACACCAACGCCGCCAGCAACAGCATCAACAACGCCGCTGGCGGCACCGCCGGCGGCAACAACAACGGCACTAAC
AACGGGCAAGGGCCAAGTCAATCGCAGCACGCGCACCCGATCCAGAGCGGGAGCGTGGCCGCTGCCATGCCCAGC
AGCGTCGCCGGGCCAGTCCACAACGCGATGCCGAACGCGATGCCGAACGGGATGCCAAACGGGATGCCAAACGGG
ATGCCCAACGGTATGTCCAGCGGGATGCCTAACGGGATGCCCAACGGGATGCCGAATGGTGTTCCCAACGGGATG
CCCAATGGGATGCCCAACGGGATGCCCAGTGGACTTCCAAATGGCATGCCTAATGGGATGCCAAACCAGGCGCAG
CAGCGCTTCCAGGCACAAATGTCGCAACCTCCCGCCTCTTCACCCGTCGTCCGGCAGGCCACTCCAGCGCAGCAA
CACATGTCGTCTCCCATGGTCGGGAGCGTTCCCATGCAGCAGACGAACTCGAGCATGGCCGCGAGCCCCTCCCGG
CCCTCGTCCGTCGTCCAGAACGCCCAGGTGCCGGCTCCCATGGCCCATAACATGTCTGCTCGGGGCAGCCAGCAG
AGCCACCCGTCGGGCACGCCTCGCATGCCTCACTCGACGCCGAACATGGCTCACGGGACGCCAATCAACAGGCCA
GCCATGTCTGCGACGCCGCGCATGAGTCAGGCGAGCCCGCCGCCCAACATGATGGCGCAAAACTCGCAGATGGGT
CCGGGTCCGGCCATGATGATGAACAACCAAGGCATGAACCAGCACAACCCCCAGGTCTTTGCCCTCGCGGCGCAG
CAGCGTGCCATCGCTCAGCAGCAGCAGCAGCAGCAGCAGCATCAGCAGCAGATAGCCGCCATGCAGAACGGGGCG
AACATGGGCTTGAACGGCCAGGGCATTTCGCAGGCGCAGCAGCAGCAGATGATGCAGGCGATGCAACGCCAAATG
CTATTGCAGCACCAACAGCAACAACAACAGCAACAGCAACAGCAACAGCAGCAGCAACATCCGCAGCAGCCGCAA
CAACACCAGCAAGGCGGTATGATGTCGGCCCAGCAGCAACAGCAGTTTGTCCAGTACGCGCAACAGCTGCAGAAC
ATGCAAGGGAACCATTTGCGTCAAATGAGTCCCCAAATGCAGGCACAGCTGCAGCAGATGGTGCGGATGGGCCAA
CTGGGCAATCCAATGCAGAGGCAGGTCAGTGGCCAGATGATGAACGGCGGCAACGCCAACATGCAGGCGCTCGCG
GCGATGCAAATGCAGCAGCAGCATCAGCAGCAGCATCAGCAGCAGCAGCATCAGCAGCAGCCCCAGCCCCAGCCC
CAGCCTCCGCAACAACAACAGCAGCCCCAGCAACATCATCAGCCCCAGCAGCAGCATCAGCCCCAGCAGCCAGGG
CAACCCTCCCAGGCGGGCGCAAACCCGATCCAAGTTCAGATCCAGAACAACGCCCGCCAGATATACGGGAGACTG
GTGCAGAGCGCCATCTCGAAGTATGGCGCGCCCGAGAACATCCCCCCGGACATCATCGAGAAGATGAAGCAAACC
GCCATGGCCCAGTCGCAACACTTGCTGCAGCAGACCATGGCACAGAGACGGATGCATCAGCAGCAGATGCTTTTG
CAACAGCAACAACAACATCAACAGCAGCAACAGCAGCAACAACCCCAACAGCAACAGCAACAACAAAATGGCATG
CAGGGGATGAATGGCATGATGGGGCATCAGGGGATGTAG
Transcript >Hirsu2|4717
ATGGCGCCCAGCAGCCCCGTCGTCCAGCAGAATGGCGCGACCAAGATCAAGCGCCCCGTCCCGCCAGGCATCCAG
ACCAACGGGGCCGCGCCGTCGACGTCGTCGCCCTCGCCGTCCATGTCCGCCAAGAAGCCGCCGCCGAGCGCGAAG
CTGCCCCCGAACTCGGCCGGCGACCGCACCATCACCGCCTCCACCGTCCGTCCCGTCAACCGAGCTCGCCGCGAG
CCGTCGTCCCAGGCGCCCGGCAGGAACTCACGGAACAGCACCGGCATCCGCTCCGCCTCCTTCTGCGTCGACATG
CCTGTCCAGGATGCAGAACCCTTACCATACGTTGTCCCCGACTCCTACATCCTCAAGAAGTTCGCCGGCCGCCCC
CCGTCACTCGTCGTACACGTGCACCCGACGCACTTTCGCTTCGATGGCCAGGATGGCATGTTCCAGTACAAGTCG
CCCATGCGCACATTCATCGAGCATTTGCGAACCCGCACGATCCCGCACGACCTCCTCGAGTACTTCAACCAGGCC
AACGTGCCCTTCTACGATGGGCGCCTCATCGTCCAAATCCATGATCACAAGACCGTCGCCCAGGCCAAAGACGCC
GCGAAGCCATCTCCCAAATCCTCATCGAACGCAGTCGTGCCGTCATCTATCCACAACTACAACCAGTGTCTGACG
CCGTCGCCCTACATCCCGTTCCCAAAGGAGGACCAGGCAACCGCCGAGGAGCCCGTCAGGGAAGAGGCAGAAGTG
AAGAAGGAGGAAAGCGGCAAGGAGGGTGAGAAGGCGCCACAGGATGGTTCGAAGACTAAAACGCCCTCGAAGCCC
AGGACATTCACTGTCGTCCTGCACCCCACACAAGAGAGTTTGCAAGTCGACTTGCGACTCAAGGCCATGACCCCC
AGAGGATCGAGCGACGCACGTGGCGAGGTGGTGACCATGGCCCAGCCGTCGACACCCATATCTCTCGTCCCCCCG
ACTCCCACCGCCGCCAACATGCCACCTCCCGCAACACGTCCCGCCAAGAGGCAGCTGATGGAACTGGACGCGGCC
AACATCTACGCCGCCGAGGGGCAGATTCTACTGGCCACCACCCCGCGACTGATGCTGAAGCCGACCAGGGACGCT
GAGGAAACCATCGCGCTCCTGGAGGCCATGGGTCATCCCAAACACTCCGAGCCGCCACCGCAGCCCAAGACGAGA
AAGAGAACGGTGGCCGAGATGGCTGCCGACGAGGCTGCCGCCGCCGAGCAGGAACGCTACATGCTCCTCCTGGAC
GACCGGCTTTCTTCGGGCCTGACCGGTGCCCAGGGCTCAGGGGGTGCCGACGGAGATGCGCAGACCGGCGCTGCC
ACCTTCGAGCCCAGGTTTGAGCGATTCAAGCTCCTCGACGACCTTTGCAGAGAACAGGCGGAGAAGAAGGAGCAG
GAGCGGATCAAGCAGCAAGAGAACGACCGGAGGATGCAGCTTCAGAGACAACAGGAGGCCGTGCAGCGGCAGCAG
GCAGAAGCGGAAAAGGCCCGGCGAGACGCTGCCGCGGCGAGGGAGAACCAGCTGCGGCAGGCAGAGGCGCAGCGT
CAGCAGGCCATGACGGCCCGCGCAGGTTCTAATGCCCCGGCGCCCCCGAGTAACATGAACAGCGGTAACGGCAAC
AACACCAACGCCGCCAGCAACAGCATCAACAACGCCGCTGGCGGCACCGCCGGCGGCAACAACAACGGCACTAAC
AACGGGCAAGGGCCAAGTCAATCGCAGCACGCGCACCCGATCCAGAGCGGGAGCGTGGCCGCTGCCATGCCCAGC
AGCGTCGCCGGGCCAGTCCACAACGCGATGCCGAACGCGATGCCGAACGGGATGCCAAACGGGATGCCAAACGGG
ATGCCCAACGGTATGTCCAGCGGGATGCCTAACGGGATGCCCAACGGGATGCCGAATGGTGTTCCCAACGGGATG
CCCAATGGGATGCCCAACGGGATGCCCAGTGGACTTCCAAATGGCATGCCTAATGGGATGCCAAACCAGGCGCAG
CAGCGCTTCCAGGCACAAATGTCGCAACCTCCCGCCTCTTCACCCGTCGTCCGGCAGGCCACTCCAGCGCAGCAA
CACATGTCGTCTCCCATGGTCGGGAGCGTTCCCATGCAGCAGACGAACTCGAGCATGGCCGCGAGCCCCTCCCGG
CCCTCGTCCGTCGTCCAGAACGCCCAGGTGCCGGCTCCCATGGCCCATAACATGTCTGCTCGGGGCAGCCAGCAG
AGCCACCCGTCGGGCACGCCTCGCATGCCTCACTCGACGCCGAACATGGCTCACGGGACGCCAATCAACAGGCCA
GCCATGTCTGCGACGCCGCGCATGAGTCAGGCGAGCCCGCCGCCCAACATGATGGCGCAAAACTCGCAGATGGGT
CCGGGTCCGGCCATGATGATGAACAACCAAGGCATGAACCAGCACAACCCCCAGGTCTTTGCCCTCGCGGCGCAG
CAGCGTGCCATCGCTCAGCAGCAGCAGCAGCAGCAGCAGCATCAGCAGCAGATAGCCGCCATGCAGAACGGGGCG
AACATGGGCTTGAACGGCCAGGGCATTTCGCAGGCGCAGCAGCAGCAGATGATGCAGGCGATGCAACGCCAAATG
CTATTGCAGCACCAACAGCAACAACAACAGCAACAGCAACAGCAACAGCAGCAGCAACATCCGCAGCAGCCGCAA
CAACACCAGCAAGGCGGTATGATGTCGGCCCAGCAGCAACAGCAGTTTGTCCAGTACGCGCAACAGCTGCAGAAC
ATGCAAGGGAACCATTTGCGTCAAATGAGTCCCCAAATGCAGGCACAGCTGCAGCAGATGGTGCGGATGGGCCAA
CTGGGCAATCCAATGCAGAGGCAGGTCAGTGGCCAGATGATGAACGGCGGCAACGCCAACATGCAGGCGCTCGCG
GCGATGCAAATGCAGCAGCAGCATCAGCAGCAGCATCAGCAGCAGCAGCATCAGCAGCAGCCCCAGCCCCAGCCC
CAGCCTCCGCAACAACAACAGCAGCCCCAGCAACATCATCAGCCCCAGCAGCAGCATCAGCCCCAGCAGCCAGGG
CAACCCTCCCAGGCGGGCGCAAACCCGATCCAAGTTCAGATCCAGAACAACGCCCGCCAGATATACGGGAGACTG
GTGCAGAGCGCCATCTCGAAGTATGGCGCGCCCGAGAACATCCCCCCGGACATCATCGAGAAGATGAAGCAAACC
GCCATGGCCCAGTCGCAACACTTGCTGCAGCAGACCATGGCACAGAGACGGATGCATCAGCAGCAGATGCTTTTG
CAACAGCAACAACAACATCAACAGCAGCAACAGCAGCAACAACCCCAACAGCAACAGCAACAACAAAATGGCATG
CAGGGGATGAATGGCATGATGGGGCATCAGGGGATGTAG
Gene >Hirsu2|4717
ATGGCGCCCAGCAGCCCCGTCGTCCAGCAGAATGGCGCGACCAAGATCAAGCGCCCCGTCCCGCCAGGCATCCAG
ACCAACGGGGCCGCGCCGTCGACGTCGTCGCCCTCGCCGTCCATGTCCGCCAAGAAGCCGCCGCCGAGCGCGAAG
CTGCCCCCGAACTCGGCCGGCGACCGCACCATCACCGCCTCCACCGTCCGTCCCGTCAACCGAGCTCGCCGCGAG
CCGTCGTCCCAGGCGCCCGGCAGGAACTCACGGAACAGCACCGGCATCCGCTCCGCCTCCTTCTGCGTCGACATG
CCTGTCCAGGATGCAGAACCCTTACCATACGGTACAGCCCTCCCCCCTTACTCGGCCTCCCCTCGCCAGCCGGCT
CCCCGCCGCAACTCCCGGCACTAACATGGCCGTCATCAGTTGTCCCCGACTCCTACATCCTCAAGAAGTTCGCCG
GCCGCCCCCCGTCACTCGTCGTACACGTGCACCCGACGCACTTTCGCTTCGATGGCCAGGATGGCATGTTCCAGT
ACAAGTCGCCCATGCGCACATTCATCGAGCATTTGCGAACCCGCACGATCCCGCACGACCTCCTCGAGTACTTCA
ACCAGGCCAACGTGCCCTTCTACGATGGGCGCCTCATCGTCCAAATCCATGATCACAAGACCGTCGCCCAGGCCA
AAGACGCCGCGAAGCCATCTCCCAAATCCTCATCGAACGCAGTCGTGCCGTCATCTATCCACAACTACAACCAGT
GTCTGACGCCGTCGCCCTACATCCCGTTCCCAAAGGAGGACCAGGCAACCGCCGAGGAGCCCGTCAGGGAAGAGG
CAGAAGTGAAGAAGGAGGAAAGCGGCAAGGAGGGTGAGAAGGCGCCACAGGATGGTTCGAAGACTAAAACGCCCT
CGAAGCCCAGGACATTCACTGTCGTCCTGCACCCCACACAAGAGAGTTTGCAAGTCGACTTGCGACTCAAGGCCA
TGACCCCCAGAGGATCGAGCGACGCACGTGGCGAGGTGGTGACCATGGCCCAGCCGTCGACACCCATATCTCTCG
TCCCCCCGACTCCCACCGCCGCCAACATGCCACCTCCCGCAACACGTCCCGCCAAGAGGCAGCTGATGGAACTGG
ACGCGGCCAACATCTACGCCGCCGAGGGGCAGATTCTACTGGCCACCACCCCGCGACTGATGCTGAAGCCGACCA
GGGACGCTGAGGAAACCATCGCGCTCCTGGAGGCCATGGGTCATCCCAAACACTCCGAGCCGCCACCGCAGCCCA
AGACGAGAAAGAGAACGGTGGCCGAGATGGCTGCCGACGAGGCTGCCGCCGCCGAGCAGGAACGCTACATGCTCC
TCCTGGACGACCGGCTTTCTTCGGGCCTGACCGGTGCCCAGGGCTCAGGGGGTGCCGACGGAGATGCGCAGACCG
GCGCTGCCACCTTCGAGCCCAGGTTTGAGCGATTCAAGCTCCTCGACGACCTTTGCAGAGAACAGGCGGAGAAGA
AGGAGCAGGAGCGGATCAAGCAGCAAGAGAACGACCGGAGGATGCAGCTTCAGAGACAACAGGAGGCCGTGCAGC
GGCAGCAGGCAGAAGCGGAAAAGGCCCGGCGAGACGCTGCCGCGGCGAGGGAGAACCAGCTGCGGCAGGCAGAGG
CGCAGCGTCAGCAGGCCATGACGGCCCGCGCAGGTTCTAATGCCCCGGCGCCCCCGAGTAACATGAACAGCGGTA
ACGGCAACAACACCAACGCCGCCAGCAACAGCATCAACAACGCCGCTGGCGGCACCGCCGGCGGCAACAACAACG
GCACTAACAACGGGCAAGGGCCAAGTCAATCGCAGCACGCGCACCCGATCCAGAGCGGGAGCGTGGCCGCTGCCA
TGCCCAGCAGCGTCGCCGGGCCAGTCCACAACGCGATGCCGAACGCGATGCCGAACGGGATGCCAAACGGGATGC
CAAACGGGATGCCCAACGGTATGTCCAGCGGGATGCCTAACGGGATGCCCAACGGGATGCCGAATGGTGTTCCCA
ACGGGATGCCCAATGGGATGCCCAACGGGATGCCCAGTGGACTTCCAAATGGCATGCCTAATGGGATGCCAAACC
AGGCGCAGCAGCGCTTCCAGGCACAAATGTCGCAACCTCCCGCCTCTTCACCCGTCGTCCGGCAGGCCACTCCAG
CGCAGCAACACATGTCGTCTCCCATGGTCGGGAGCGTTCCCATGCAGCAGACGAACTCGAGCATGGCCGCGAGCC
CCTCCCGGCCCTCGTCCGTCGTCCAGAACGCCCAGGTGCCGGCTCCCATGGCCCATAACATGTCTGCTCGGGGCA
GCCAGCAGAGCCACCCGTCGGGCACGCCTCGCATGCCTCACTCGACGCCGAACATGGCTCACGGGACGCCAATCA
ACAGGCCAGCCATGTCTGCGACGCCGCGCATGAGTCAGGCGAGCCCGCCGCCCAACATGATGGCGCAAAACTCGC
AGATGGGTCCGGGTCCGGCCATGATGATGAACAACCAAGGCATGAACCAGCACAACCCCCAGGTCTTTGCCCTCG
CGGCGCAGCAGCGTGCCATCGCTCAGCAGCAGCAGCAGCAGCAGCAGCATCAGCAGCAGATAGCCGCCATGCAGA
ACGGGGCGAACATGGGCTTGAACGGCCAGGGCATTTCGCAGGCGCAGCAGCAGCAGATGATGCAGGCGATGCAAC
GCCAAATGCTATTGCAGCACCAACAGCAACAACAACAGCAACAGCAACAGCAACAGCAGCAGCAACATCCGCAGC
AGCCGCAACAACACCAGCAAGGCGGTATGATGTCGGCCCAGCAGCAACAGCAGTTTGTCCAGTACGCGCAACAGC
TGCAGAACATGCAAGGGAACCATTTGCGTCAAATGAGTCCCCAAATGCAGGCACAGCTGCAGCAGATGGTGCGGA
TGGGCCAACTGGGCAATCCAATGCAGAGGCAGGTCAGTGGCCAGATGATGAACGGCGGCAACGCCAACATGCAGG
CGCTCGCGGCGATGCAAATGCAGCAGCAGCATCAGCAGCAGCATCAGCAGCAGCAGCATCAGCAGCAGCCCCAGC
CCCAGCCCCAGCCTCCGCAACAACAACAGCAGCCCCAGCAACATCATCAGCCCCAGCAGCAGCATCAGCCCCAGC
AGCCAGGGCAACCCTCCCAGGCGGGCGCAAACCCGATCCAAGTTCAGATCCAGAACAACGCCCGCCAGATATACG
GGAGACTGGTGCAGAGCGCCATCTCGAAGTATGGCGCGCCCGAGAACATCCCCCCGGACATCATCGAGAAGATGA
AGCAAACCGCCATGGCCCAGTCGCAACACTTGCTGCAGCAGACCATGGCACAGAGACGGATGCATCAGCAGCAGA
TGCTTTTGCAACAGCAACAACAACATCAACAGCAGCAACAGCAGCAACAACCCCAACAGCAACAGCAACAACAAA
ATGGCATGCAGGGGATGAATGGCATGATGGGGCATCAGGGGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail