Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4711
Gene name
LocationContig_2388:818..1733
Strand-
Gene length (bp)915
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 3.1E-21 9 221
PF13460 NAD_binding_10 NAD(P)H-binding 4.6E-20 13 197

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4711
MSGTPISNVAIAGAAGSLGSVLLDRLVSSGRFKVRVLRRNGSTSTLPPGVDVVDVDFDSPRSLEAALAGQHAVVS
ALGFPGLGLQRGLVDAAAAAGVRRFLPSEFGSDLSTPRARQLPVFAQKVEVADHLAAVAARSPSLTYTLVSNGPF
LDWGLRHNFLLNHAEYKPTIFDGGDVVFSSTTLGSIADAVVAILSKPDETANRTVRIEDARVSQNKLLALAREAL
PDKPWQPQPASLDAATQRSDERLARGLLDLETFAPYIYRSFLDPSVGGLFRETDNELLGIKGKTDDEVAAIVRDA
LADK*
Coding >Hirsu2|4711
ATGTCGGGAACCCCCATCAGCAACGTAGCCATCGCCGGGGCCGCCGGCAGCCTGGGATCCGTCCTGCTCGACAGG
CTCGTCTCCTCGGGCCGGTTCAAGGTGCGGGTATTGCGCCGCAACGGGTCCACGTCGACGTTGCCCCCAGGCGTC
GACGTCGTCGACGTCGACTTCGACTCGCCCCGGTCGCTCGAGGCGGCCCTGGCCGGCCAGCACGCCGTCGTCTCC
GCCCTGGGCTTCCCCGGCCTGGGCCTGCAGAGGGGCCTCGTCGACGCCGCCGCCGCCGCCGGCGTCCGCCGCTTC
CTGCCCTCCGAGTTCGGCTCCGACCTGAGCACGCCGCGGGCGCGCCAGCTGCCCGTCTTCGCCCAAAAGGTCGAG
GTGGCCGACCACCTGGCCGCCGTCGCCGCCCGCAGCCCGTCCCTGACCTACACCCTCGTCAGCAACGGGCCCTTC
CTCGACTGGGGCCTGCGCCACAACTTCCTCCTCAACCACGCCGAGTACAAGCCGACCATCTTCGACGGCGGCGAC
GTCGTCTTTAGCTCGACGACGCTCGGCAGCATCGCCGACGCCGTCGTCGCCATCCTGTCCAAGCCGGACGAGACG
GCCAACCGGACCGTCCGCATCGAGGACGCCCGCGTCTCACAGAACAAGCTGCTGGCCCTGGCCCGCGAGGCCCTG
CCCGACAAGCCGTGGCAGCCGCAGCCGGCGAGCCTCGACGCCGCCACCCAGCGGTCCGACGAGCGGCTGGCCCGG
GGCCTGCTGGACCTGGAGACGTTCGCGCCCTACATCTACCGCTCCTTCCTCGACCCCTCCGTCGGCGGTCTCTTC
CGCGAGACGGACAACGAGCTTCTTGGCATCAAGGGCAAGACGGACGACGAGGTGGCGGCCATTGTGCGCGACGCG
CTGGCCGACAAGTAG
Transcript >Hirsu2|4711
ATGTCGGGAACCCCCATCAGCAACGTAGCCATCGCCGGGGCCGCCGGCAGCCTGGGATCCGTCCTGCTCGACAGG
CTCGTCTCCTCGGGCCGGTTCAAGGTGCGGGTATTGCGCCGCAACGGGTCCACGTCGACGTTGCCCCCAGGCGTC
GACGTCGTCGACGTCGACTTCGACTCGCCCCGGTCGCTCGAGGCGGCCCTGGCCGGCCAGCACGCCGTCGTCTCC
GCCCTGGGCTTCCCCGGCCTGGGCCTGCAGAGGGGCCTCGTCGACGCCGCCGCCGCCGCCGGCGTCCGCCGCTTC
CTGCCCTCCGAGTTCGGCTCCGACCTGAGCACGCCGCGGGCGCGCCAGCTGCCCGTCTTCGCCCAAAAGGTCGAG
GTGGCCGACCACCTGGCCGCCGTCGCCGCCCGCAGCCCGTCCCTGACCTACACCCTCGTCAGCAACGGGCCCTTC
CTCGACTGGGGCCTGCGCCACAACTTCCTCCTCAACCACGCCGAGTACAAGCCGACCATCTTCGACGGCGGCGAC
GTCGTCTTTAGCTCGACGACGCTCGGCAGCATCGCCGACGCCGTCGTCGCCATCCTGTCCAAGCCGGACGAGACG
GCCAACCGGACCGTCCGCATCGAGGACGCCCGCGTCTCACAGAACAAGCTGCTGGCCCTGGCCCGCGAGGCCCTG
CCCGACAAGCCGTGGCAGCCGCAGCCGGCGAGCCTCGACGCCGCCACCCAGCGGTCCGACGAGCGGCTGGCCCGG
GGCCTGCTGGACCTGGAGACGTTCGCGCCCTACATCTACCGCTCCTTCCTCGACCCCTCCGTCGGCGGTCTCTTC
CGCGAGACGGACAACGAGCTTCTTGGCATCAAGGGCAAGACGGACGACGAGGTGGCGGCCATTGTGCGCGACGCG
CTGGCCGACAAGTAG
Gene >Hirsu2|4711
ATGTCGGGAACCCCCATCAGCAACGTAGCCATCGCCGGGGCCGCCGGCAGCCTGGGATCCGTCCTGCTCGACAGG
CTCGTCTCCTCGGGCCGGTTCAAGGTGCGGGTATTGCGCCGCAACGGGTCCACGTCGACGTTGCCCCCAGGCGTC
GACGTCGTCGACGTCGACTTCGACTCGCCCCGGTCGCTCGAGGCGGCCCTGGCCGGCCAGCACGCCGTCGTCTCC
GCCCTGGGCTTCCCCGGCCTGGGCCTGCAGAGGGGCCTCGTCGACGCCGCCGCCGCCGCCGGCGTCCGCCGCTTC
CTGCCCTCCGAGTTCGGCTCCGACCTGAGCACGCCGCGGGCGCGCCAGCTGCCCGTCTTCGCCCAAAAGGTCGAG
GTGGCCGACCACCTGGCCGCCGTCGCCGCCCGCAGCCCGTCCCTGACCTACACCCTCGTCAGCAACGGGCCCTTC
CTCGACTGGGGCCTGCGCCACAACTTCCTCCTCAACCACGCCGAGTACAAGCCGACCATCTTCGACGGCGGCGAC
GTCGTCTTTAGCTCGACGACGCTCGGCAGCATCGCCGACGCCGTCGTCGCCATCCTGTCCAAGCCGGACGAGACG
GCCAACCGGACCGTCCGCATCGAGGACGCCCGCGTCTCACAGAACAAGCTGCTGGCCCTGGCCCGCGAGGCCCTG
CCCGACAAGCCGTGGCAGCCGCAGCCGGCGAGCCTCGACGCCGCCACCCAGCGGTCCGACGAGCGGCTGGCCCGG
GGCCTGCTGGACCTGGAGACGTTCGCGCCCTACATCTACCGCTCCTTCCTCGACCCCTCCGTCGGCGGTCTCTTC
CGCGAGACGGACAACGAGCTTCTTGGCATCAAGGGCAAGACGGACGACGAGGTGGCGGCCATTGTGCGCGACGCG
CTGGCCGACAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail