Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4709
Gene name
LocationContig_2386:425..2329
Strand+
Gene length (bp)1904
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 6.6E-03 549 573

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59VM4|RPN4_CANAL Transcriptional regulator RPN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPN4 PE=1 SV=1 510 573 4.0E-17
sp|Q9Y815|RSV2_SCHPO Zinc finger protein rsv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv2 PE=3 SV=1 506 573 3.0E-15
sp|Q03465|RPN4_YEAST Protein RPN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN4 PE=1 SV=1 512 583 8.0E-12

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4709
MISSLPQGESPHNHRSRTHFHRQYPFPCESPENSFRLYTVVDNSTHFNHSPALLSLNPNDSVITRNGLRFGFAGT
MHSDAWDSTTQLMPKPSRLSDQRESSTSSLGGTLDSTSPLSGNVNTCNPQVAISDSVFSGITELRSHEPTRPQMT
YPLAVSSPHKKPRSDRSLLPAPELAPGRTRSPSRLASAASPTAGDSPATPSSTDNDHLGRRRTDFCNVPKLDRTM
TDVYGDELYSPNFSITSTSPSQRQAASSPSNDVFHQRIHAANSQHLSAAKSPSSTVSRTRSSPFRTGSPFALSSN
TSANVVHLNSSQRIRGQNQIRKESTLLPQQGAVLEPETPKTISPKDAILEFNDTDTESSFPLFPADVTHLDNDVI
IAKSEGNEVGVQDTDGTNAVGFLQSQVFANMPVTQQFACASEHGLDHRTPPRLSSSASTSTTSGNSTPIIVTKPP
VTGADGGTYTCTYHGCTQRFETPLQLQKHKREGHRQAQTVAGPRETGACMNMLNTQAGPHRCDRINPSTGKPCCT
IFSRPYDLTRHEDTIHNARKQKVRCDLCTEEKTFSRADALTRHYRVCHPEVELPGKHKRRGGI*
Coding >Hirsu2|4709
ATGATCTCATCCCTACCTCAGGGCGAGTCACCTCACAACCATCGCTCTCGAACTCATTTTCATCGCCAGTATCCT
TTTCCGTGCGAGTCTCCTGAGAACTCCTTTCGACTCTACACGGTAGTCGATAACTCGACGCATTTTAATCATTCA
CCTGCTCTACTGTCACTCAACCCCAACGACAGCGTCATCACTCGCAACGGTCTACGATTCGGGTTCGCCGGGACA
ATGCACTCGGATGCTTGGGACTCCACGACCCAGCTGATGCCCAAGCCTAGTCGGTTGTCGGATCAACGCGAATCT
TCTACATCATCACTGGGAGGGACTTTAGACTCTACTTCGCCCTTGTCCGGGAACGTGAACACGTGCAATCCGCAG
GTCGCGATCTCTGATTCTGTCTTCAGTGGCATAACCGAATTACGATCCCACGAACCTACGCGGCCTCAGATGACA
TATCCTTTGGCTGTGTCGAGCCCGCACAAGAAGCCACGCAGCGACCGCAGTCTGTTGCCCGCTCCCGAACTCGCC
CCGGGCCGCACTCGATCTCCATCTCGTCTGGCGTCCGCGGCGAGCCCAACTGCCGGCGATTCTCCTGCGACGCCG
AGCAGTACTGATAATGACCATCTTGGCCGAAGAAGAACTGACTTCTGTAACGTCCCCAAGCTTGATCGCACAATG
ACAGACGTCTACGGTGATGAGTTGTATAGCCCGAATTTCTCTATAACGTCGACATCGCCATCCCAGCGGCAGGCA
GCATCATCGCCCAGCAACGATGTCTTTCACCAACGAATTCACGCCGCAAATAGTCAACATTTGAGCGCTGCGAAG
TCACCATCGTCCACCGTCTCGAGGACTCGATCATCTCCATTTCGGACTGGCTCTCCCTTTGCTCTATCATCGAAT
ACTTCCGCAAACGTTGTACACCTCAACTCGTCACAGCGGATAAGAGGGCAGAATCAAATTCGCAAGGAATCAACA
TTACTACCACAGCAGGGAGCCGTCCTGGAACCGGAGACGCCCAAGACCATATCTCCAAAAGACGCCATACTTGAG
TTCAACGACACGGACACAGAATCAAGTTTTCCTTTGTTCCCCGCGGACGTTACACACTTGGACAACGACGTAATA
ATTGCGAAGTCTGAAGGCAATGAAGTGGGTGTCCAAGATACGGACGGCACAAATGCCGTAGGATTTCTCCAATCC
CAGGTTTTTGCGAACATGCCAGTGACGCAGCAGTTCGCATGTGCATCTGAACACGGGTTGGATCATCGAACACCT
CCACGCCTAAGCTCCTCTGCCTCCACCTCGACCACATCCGGCAATAGCACACCTATCATCGTTACAAAACCTCCA
GTAACAGGTGCCGATGGTGGCACATATACTTGCACATATCATGGCTGCACTCAACGATTTGAAACTCCCTTACAA
CTCCAAAAACATAAGAGAGAGGGACACAGGCAGGCACAGACAGTGGCAGGACCGCGCGAAACAGGTGCCTGTATG
AATATGTTGAACACTCAAGCTGGACCCCATCGCTGCGACCGAATCAACCCAAGCACTGGCAAGCCATGCTGCACA
ATCTTTTCTCGACCATACGACTTGACAAGACATGAAGACACTATCCACAATGCCCGCAAACAAAAGGTTCGGTGC
GACCTATGTACCGAAGAGAAGACGTTCAGCCGCGCCGACGCATTGACGAGACATTACCGCGTGTGCCACCCTGAG
GTGGAACTGCCAGGCAAGCACAAGAGGCGTGGGGGAATATGA
Transcript >Hirsu2|4709
ATGATCTCATCCCTACCTCAGGGCGAGTCACCTCACAACCATCGCTCTCGAACTCATTTTCATCGCCAGTATCCT
TTTCCGTGCGAGTCTCCTGAGAACTCCTTTCGACTCTACACGGTAGTCGATAACTCGACGCATTTTAATCATTCA
CCTGCTCTACTGTCACTCAACCCCAACGACAGCGTCATCACTCGCAACGGTCTACGATTCGGGTTCGCCGGGACA
ATGCACTCGGATGCTTGGGACTCCACGACCCAGCTGATGCCCAAGCCTAGTCGGTTGTCGGATCAACGCGAATCT
TCTACATCATCACTGGGAGGGACTTTAGACTCTACTTCGCCCTTGTCCGGGAACGTGAACACGTGCAATCCGCAG
GTCGCGATCTCTGATTCTGTCTTCAGTGGCATAACCGAATTACGATCCCACGAACCTACGCGGCCTCAGATGACA
TATCCTTTGGCTGTGTCGAGCCCGCACAAGAAGCCACGCAGCGACCGCAGTCTGTTGCCCGCTCCCGAACTCGCC
CCGGGCCGCACTCGATCTCCATCTCGTCTGGCGTCCGCGGCGAGCCCAACTGCCGGCGATTCTCCTGCGACGCCG
AGCAGTACTGATAATGACCATCTTGGCCGAAGAAGAACTGACTTCTGTAACGTCCCCAAGCTTGATCGCACAATG
ACAGACGTCTACGGTGATGAGTTGTATAGCCCGAATTTCTCTATAACGTCGACATCGCCATCCCAGCGGCAGGCA
GCATCATCGCCCAGCAACGATGTCTTTCACCAACGAATTCACGCCGCAAATAGTCAACATTTGAGCGCTGCGAAG
TCACCATCGTCCACCGTCTCGAGGACTCGATCATCTCCATTTCGGACTGGCTCTCCCTTTGCTCTATCATCGAAT
ACTTCCGCAAACGTTGTACACCTCAACTCGTCACAGCGGATAAGAGGGCAGAATCAAATTCGCAAGGAATCAACA
TTACTACCACAGCAGGGAGCCGTCCTGGAACCGGAGACGCCCAAGACCATATCTCCAAAAGACGCCATACTTGAG
TTCAACGACACGGACACAGAATCAAGTTTTCCTTTGTTCCCCGCGGACGTTACACACTTGGACAACGACGTAATA
ATTGCGAAGTCTGAAGGCAATGAAGTGGGTGTCCAAGATACGGACGGCACAAATGCCGTAGGATTTCTCCAATCC
CAGGTTTTTGCGAACATGCCAGTGACGCAGCAGTTCGCATGTGCATCTGAACACGGGTTGGATCATCGAACACCT
CCACGCCTAAGCTCCTCTGCCTCCACCTCGACCACATCCGGCAATAGCACACCTATCATCGTTACAAAACCTCCA
GTAACAGGTGCCGATGGTGGCACATATACTTGCACATATCATGGCTGCACTCAACGATTTGAAACTCCCTTACAA
CTCCAAAAACATAAGAGAGAGGGACACAGGCAGGCACAGACAGTGGCAGGACCGCGCGAAACAGGTGCCTGTATG
AATATGTTGAACACTCAAGCTGGACCCCATCGCTGCGACCGAATCAACCCAAGCACTGGCAAGCCATGCTGCACA
ATCTTTTCTCGACCATACGACTTGACAAGACATGAAGACACTATCCACAATGCCCGCAAACAAAAGGTTCGGTGC
GACCTATGTACCGAAGAGAAGACGTTCAGCCGCGCCGACGCATTGACGAGACATTACCGCGTGTGCCACCCTGAG
GTGGAACTGCCAGGCAAGCACAAGAGGCGTGGGGGAATATGA
Gene >Hirsu2|4709
ATGATCTCATCCCTACCTCAGGGCGAGTCACCTCACAACCATCGCTCTCGAACTCATTTTCATCGCCAGTATCCT
TTTCCGTGCGAGTCTCCTGAGAACTCCTTTCGACTCTACACGGTAGTCGATAACTCGACGCATTTTAATCATTCA
CCTGCTCTACTGTCACTCAACCCCAACGACAGCGTCATCACTCGCAACGGTCTACGATTCGGGTTCGCCGGGACA
ATGCACTCGGATGCTTGGGACTCCACGACCCAGCTGATGCCCAAGCCTAGTCGGTTGTCGGATCAACGCGAATCT
TCTACATCATCACTGGGAGGGACTTTAGACTCTACTTCGCCCTTGTCCGGGAACGTGAACACGTGCAATCCGCAG
GTCGCGATCTCTGATTCTGTCTTCAGTGGCATAACCGAATTACGATCCCACGAACCTACGCGGCCTCAGGTGAAT
ACCCTACATCAGTCCGCCAGGCCCTTAAACGCCTATCCTTCATGCCGTAACCTTGACAATGTCATACCATCGAAG
ATGACATATCCTTTGGCTGTGTCGAGCCCGCACAAGAAGCCACGCAGCGACCGCAGTCTGTTGCCCGCTCCCGAA
CTCGCCCCGGGCCGCACTCGATCTCCATCTCGTCTGGCGTCCGCGGCGAGCCCAACTGCCGGCGATTCTCCTGCG
ACGCCGAGCAGTACTGATAATGACCATCTTGGCCGAAGAAGAACTGGTACGCCCTTCTCCTTCGTGAATGAAAAC
GTTCGACAGCGCTGATGGTAATTTCAGACTTCTGTAACGTCCCCAAGCTTGATCGCACAATGACAGACGTCTACG
GTGATGAGTTGTATAGCCCGAATTTCTCTATAACGTCGACATCGCCATCCCAGCGGCAGGCAGCATCATCGCCCA
GCAACGATGTCTTTCACCAACGAATTCACGCCGCAAATAGTCAACATTTGAGCGCTGCGAAGTCACCATCGTCCA
CCGTCTCGAGGACTCGATCATCTCCATTTCGGACTGGCTCTCCCTTTGCTCTATCATCGAATACTTCCGCAAACG
TTGTACACCTCAACTCGTCACAGCGGATAAGAGGGCAGAATCAAATTCGCAAGGAATCAACATTACTACCACAGC
AGGGAGCCGTCCTGGAACCGGAGACGCCCAAGACCATATCTCCAAAAGACGCCATACTTGAGTTCAACGACACGG
ACACAGAATCAAGTTTTCCTTTGTTCCCCGCGGACGTTACACACTTGGACAACGACGTAATAATTGCGAAGTCTG
AAGGCAATGAAGTGGGTGTCCAAGATACGGACGGCACAAATGCCGTAGGATTTCTCCAATCCCAGGTTTTTGCGA
ACATGCCAGTGACGCAGCAGTTCGCATGTGCATCTGAACACGGGTTGGATCATCGAACACCTCCACGCCTAAGCT
CCTCTGCCTCCACCTCGACCACATCCGGCAATAGCACACCTATCATCGTTACAAAACCTCCAGTAACAGGTGCCG
ATGGTGGCACATATACTTGCACATATCATGGCTGCACTCAACGATTTGAAACTCCCTTACAACTCCAAAAACATA
AGAGAGAGGGACACAGGCAGGCACAGACAGTGGCAGGACCGCGCGAAACAGGTGCCTGTATGAATATGTTGAACA
CTCAAGCTGGACCCCATCGCTGCGACCGAATCAACCCAAGCACTGGCAAGCCATGCTGCACAATCTTTTCTCGAC
CATACGACTTGACAAGACATGAAGACACTATCCACAATGCCCGCAAACAAAAGGTTCGGTGCGACCTATGTACCG
AAGAGAAGACGTTCAGCCGCGCCGACGCATTGACGAGACATTACCGCGTGTGCCACCCTGAGGTGGAACTGCCAG
GCAAGCACAAGAGGCGTGGGGGAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail