Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4704
Gene name
LocationContig_2380:2343..2712
Strand-
Gene length (bp)369
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9) 5.0E-18 8 66

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4131 0.7002 0.0652 0.063 0.1423 0.0126 0.1109 0.0424 0.1731 0.0558

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2339
Ophiocordyceps australis map64 (Brazil) OphauB2|816
Ophiocordyceps camponoti-floridani Ophcf2|05662
Ophiocordyceps camponoti-rufipedis Ophun1|818
Ophiocordyceps kimflemingae Ophio5|6267
Ophiocordyceps subramaniannii Hirsu2|4704 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4704
MKAVRPRAKQQGDEDDAPVVKKPPRGSLVLKTYDPGSGITLKYRTTKAAEVSRLVHSALGRLGRSMAAMPTNVPD
VLTPDAPGSFEGAAEAEVGSVANASRQPPHQQSQQPGAGKKKRRGRK*
Coding >Hirsu2|4704
ATGAAGGCTGTTCGGCCTAGGGCTAAACAGCAAGGCGATGAGGACGATGCACCGGTGGTAAAGAAGCCGCCCCGC
GGCAGCCTCGTGCTCAAGACATATGATCCAGGCAGCGGCATCACGCTTAAGTACCGAACTACCAAGGCTGCAGAA
GTGTCTCGACTCGTACATTCTGCTCTGGGCCGACTCGGAAGATCTATGGCTGCCATGCCCACCAACGTCCCCGAC
GTGCTGACGCCCGACGCTCCGGGAAGTTTCGAGGGCGCCGCAGAAGCAGAGGTTGGCTCGGTAGCCAATGCGTCC
AGACAACCGCCACATCAACAGTCGCAGCAGCCGGGAGCTGGCAAGAAGAAGCGGAGAGGACGGAAGTAG
Transcript >Hirsu2|4704
ATGAAGGCTGTTCGGCCTAGGGCTAAACAGCAAGGCGATGAGGACGATGCACCGGTGGTAAAGAAGCCGCCCCGC
GGCAGCCTCGTGCTCAAGACATATGATCCAGGCAGCGGCATCACGCTTAAGTACCGAACTACCAAGGCTGCAGAA
GTGTCTCGACTCGTACATTCTGCTCTGGGCCGACTCGGAAGATCTATGGCTGCCATGCCCACCAACGTCCCCGAC
GTGCTGACGCCCGACGCTCCGGGAAGTTTCGAGGGCGCCGCAGAAGCAGAGGTTGGCTCGGTAGCCAATGCGTCC
AGACAACCGCCACATCAACAGTCGCAGCAGCCGGGAGCTGGCAAGAAGAAGCGGAGAGGACGGAAGTAG
Gene >Hirsu2|4704
ATGAAGGCTGTTCGGCCTAGGGCTAAACAGCAAGGCGATGAGGACGATGCACCGGTGGTAAAGAAGCCGCCCCGC
GGCAGCCTCGTGCTCAAGACATATGATCCAGGCAGCGGCATCACGCTTAAGTACCGAACTACCAAGGCTGCAGAA
GTGTCTCGACTCGTACATTCTGCTCTGGGCCGACTCGGAAGATCTATGGCTGCCATGCCCACCAACGTCCCCGAC
GTGCTGACGCCCGACGCTCCGGGAAGTTTCGAGGGCGCCGCAGAAGCAGAGGTTGGCTCGGTAGCCAATGCGTCC
AGACAACCGCCACATCAACAGTCGCAGCAGCCGGGAGCTGGCAAGAAGAAGCGGAGAGGACGGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail