Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|47
Gene name
LocationContig_1002:1971..5247
Strand+
Gene length (bp)3276
Transcript length (bp)3045
Coding sequence length (bp)3045
Protein length (aa) 1015

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05843 Suf Suppressor of forked protein (Suf) 2.8E-83 616 912

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S1Y0|RNA14_NEUCR mRNA 3'-end-processing protein rna-14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rna-14 PE=3 SV=1 145 977 0.0E+00
sp|Q4WXX4|RNA14_ASPFU mRNA 3'-end-processing protein rna14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rna14 PE=3 SV=1 133 912 0.0E+00
sp|Q2UKV8|RNA14_ASPOR mRNA 3'-end-processing protein rna14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rna14 PE=3 SV=1 145 912 0.0E+00
sp|Q5B3I8|RNA14_EMENI mRNA 3'-end-processing protein rna14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rna14 PE=3 SV=2 145 912 0.0E+00
sp|Q4IR09|RNA14_GIBZE mRNA 3'-end-processing protein RNA14 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RNA14 PE=3 SV=1 1 1013 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S1Y0|RNA14_NEUCR mRNA 3'-end-processing protein rna-14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rna-14 PE=3 SV=1 145 977 0.0E+00
sp|Q4WXX4|RNA14_ASPFU mRNA 3'-end-processing protein rna14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rna14 PE=3 SV=1 133 912 0.0E+00
sp|Q2UKV8|RNA14_ASPOR mRNA 3'-end-processing protein rna14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rna14 PE=3 SV=1 145 912 0.0E+00
sp|Q5B3I8|RNA14_EMENI mRNA 3'-end-processing protein rna14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rna14 PE=3 SV=2 145 912 0.0E+00
sp|Q4IR09|RNA14_GIBZE mRNA 3'-end-processing protein RNA14 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RNA14 PE=3 SV=1 1 1013 0.0E+00
sp|Q6C8L8|RNA14_YARLI mRNA 3'-end-processing protein RNA14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RNA14 PE=3 SV=1 84 913 1.0E-101
sp|Q4PCV8|RNA14_USTMA mRNA 3'-end-processing protein RNA14 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RNA14 PE=3 SV=1 129 781 3.0E-94
sp|O14233|RNA14_SCHPO mRNA 3'-end-processing protein rna14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna14 PE=3 SV=1 124 773 3.0E-93
sp|P0CO12|RNA14_CRYNJ mRNA 3'-end-processing protein RNA14 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RNA14 PE=3 SV=1 185 911 3.0E-90
sp|P0CO13|RNA14_CRYNB mRNA 3'-end-processing protein RNA14 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RNA14 PE=3 SV=1 185 911 3.0E-90
sp|Q6BJD8|RNA14_DEBHA mRNA 3'-end-processing protein RNA14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RNA14 PE=3 SV=2 162 781 2.0E-63
sp|P25298|RNA14_YEAST mRNA 3'-end-processing protein RNA14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA14 PE=1 SV=2 148 773 6.0E-62
sp|Q5RDW9|CSTF3_PONAB Cleavage stimulation factor subunit 3 OS=Pongo abelii GN=CSTF3 PE=2 SV=1 170 506 4.0E-50
sp|Q12996|CSTF3_HUMAN Cleavage stimulation factor subunit 3 OS=Homo sapiens GN=CSTF3 PE=1 SV=1 170 506 1.0E-49
sp|Q99LI7|CSTF3_MOUSE Cleavage stimulation factor subunit 3 OS=Mus musculus GN=Cstf3 PE=1 SV=1 170 506 1.0E-49
sp|P25991|SUF_DROME Protein suppressor of forked OS=Drosophila melanogaster GN=su(f) PE=1 SV=2 180 482 6.0E-47
sp|Q6FU45|RNA14_CANGA mRNA 3'-end-processing protein RNA14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RNA14 PE=3 SV=1 185 506 2.0E-43
sp|Q759Y6|RNA14_ASHGO mRNA 3'-end-processing protein RNA14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RNA14 PE=3 SV=1 172 507 3.0E-42
sp|Q6CII8|RNA14_KLULA mRNA 3'-end-processing protein RNA14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RNA14 PE=1 SV=1 145 773 1.0E-41
sp|Q8GUP1|CTF77_ARATH Cleavage stimulation factor subunit 77 OS=Arabidopsis thaliana GN=CSTF77 PE=1 SV=1 203 506 2.0E-36
sp|Q6FU45|RNA14_CANGA mRNA 3'-end-processing protein RNA14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RNA14 PE=3 SV=1 613 773 7.0E-15
sp|Q8GUP1|CTF77_ARATH Cleavage stimulation factor subunit 77 OS=Arabidopsis thaliana GN=CSTF77 PE=1 SV=1 593 758 1.0E-13
sp|Q99LI7|CSTF3_MOUSE Cleavage stimulation factor subunit 3 OS=Mus musculus GN=Cstf3 PE=1 SV=1 579 923 1.0E-12
sp|Q5RDW9|CSTF3_PONAB Cleavage stimulation factor subunit 3 OS=Pongo abelii GN=CSTF3 PE=2 SV=1 579 923 1.0E-12
sp|Q12996|CSTF3_HUMAN Cleavage stimulation factor subunit 3 OS=Homo sapiens GN=CSTF3 PE=1 SV=1 579 923 1.0E-12
sp|Q759Y6|RNA14_ASHGO mRNA 3'-end-processing protein RNA14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RNA14 PE=3 SV=1 612 773 5.0E-12
sp|P25991|SUF_DROME Protein suppressor of forked OS=Drosophila melanogaster GN=su(f) PE=1 SV=2 616 760 1.0E-09
sp|Q1JPZ7|PRP39_DANRE Pre-mRNA-processing factor 39 OS=Danio rerio GN=prpf39 PE=2 SV=2 69 347 3.0E-09
sp|Q4KLU2|PRP39_XENLA Pre-mRNA-processing factor 39 OS=Xenopus laevis GN=prpf39 PE=2 SV=1 180 473 1.0E-08
sp|Q8K2Z2|PRP39_MOUSE Pre-mRNA-processing factor 39 OS=Mus musculus GN=Prpf39 PE=1 SV=3 180 366 4.0E-08
sp|Q86UA1|PRP39_HUMAN Pre-mRNA-processing factor 39 OS=Homo sapiens GN=PRPF39 PE=1 SV=3 173 473 5.0E-08
sp|Q5AM44|RNA14_CANAL mRNA 3'-end-processing protein RNA14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RNA14 PE=3 SV=1 607 781 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006397 mRNA processing Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043226 organelle No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0043229 intracellular organelle No
GO:0043227 membrane-bounded organelle No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044464 cell part No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044424 intracellular part No
GO:0006396 RNA processing No
GO:0016071 mRNA metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|47
MASDDVTWEGGEYAATDEGQAQTSDEQADAVADDTSPADDAAENDDDADDGADYDPESVAFDTSPSAPDQAAAPS
AAPQRSAPPKPKMSGGFLVEVSDDDEEEEEEEEEEEEEEEEEGEEGDNDAPKNAEPPVQDQATPVKNGVSSAPPA
DKSPPVPQAAPSLDAVSLLEVRIKEDPRGDLNAWLSLVAEHKRRGRIDDVRSVYSRFLEVFPQAADIWVEWIEME
LNMDNFVEAERLFGRSLMSVLNVKLWTIYLNYIRRRNDLTNDSSGSARRTVAQSYDFVIDNIGVDRDSGNIWQDY
ISFVKSGPGQVGGTGWQDQQKMDQLRKAYQRAITVPMLTVNTMWKEYDQFEMALNKVTGRKFIQERSPGYMSAKS
GNIALDNMTRHLKRTNLPRLPPAPGFDGDEDFRNQVELWKKWIAWEKEDPLVLKDDEPHVFKQRVVYCYKQALMA
LRFWPEIWVDAATWCLENDVRDGDNKPVGTEMLLQGIAANPESVLLAFKHADHIEAHYPEKEGDKSEYAKAVRQP
YDAVLETLYKMGDKVKEHEKLEVSALKLAAAQGPSMQESIEPIDDDDDDDDDDDEEKKKKKKEKKSPMEERIAAI
QNAHAAESQLLSRTISYVWIALARAMRRIQGKGNQSESGLRKVFTDARQKGRLTSDVYVAVALLESVVYKDPVGS
KIFERGARLFPNDEGFMIEYIKFLHAKDDTTNARVVFETCANRLVSKPETLHKAKPLYAYFHKYESQYGELSQIS
KLEERMAELFPKDPKLSYFTARYSSDKFDPVAAPIIISKAAQMRPKLGIPTIEQPVSARNSVPPARQEQSPRPQY
VRATASPKRPFGVDEEDLNPPKRLARGASPLKGAAGRRLDQQRRNQASALHRDITFLLGILPPAHSYDAQRLNPA
AMTSLLRDMPLPDYSTWRAKTGGQYRTPVLGHVRQTSGDFGGRPMSPYGRVASGASVYRSSPLRTESGGAYAGNP
YAGAPEAGAVPSVWPALSGVHGGGSVPGPPGQYGGFRFQ*
Coding >Hirsu2|47
ATGGCCTCCGACGACGTGACGTGGGAAGGGGGTGAATACGCCGCCACCGATGAAGGTCAGGCTCAGACGAGCGAC
GAGCAAGCCGATGCCGTCGCGGACGACACCTCGCCGGCCGACGATGCGGCTGAAAACGATGATGACGCGGACGAC
GGCGCAGATTACGACCCCGAGTCCGTGGCCTTTGACACGAGTCCCTCGGCACCTGACCAAGCCGCCGCCCCTTCC
GCCGCGCCGCAACGCTCGGCACCTCCTAAACCTAAGATGTCGGGAGGCTTCCTCGTTGAGGTATCGGACGACGAC
GAGGAGGAGGAAGAAGAAGAAGAAGAAGAGGAGGAGGAGGAGGAGGAGGAGGGGGAGGAGGGAGACAATGACGCC
CCGAAAAACGCAGAACCACCAGTCCAAGACCAGGCGACTCCCGTTAAAAACGGAGTTTCGTCTGCGCCTCCGGCA
GACAAATCCCCTCCTGTGCCACAAGCAGCTCCGAGCCTCGATGCCGTCTCGCTCCTCGAAGTGCGCATCAAGGAG
GATCCCCGAGGAGACTTGAACGCATGGCTGAGCCTCGTGGCCGAGCACAAGCGTCGCGGCAGGATTGACGACGTA
CGGAGTGTATACAGTCGATTTCTCGAAGTCTTTCCGCAAGCAGCCGATATCTGGGTGGAGTGGATAGAGATGGAG
CTCAACATGGACAACTTCGTGGAGGCCGAGAGGTTGTTTGGCCGAAGCCTCATGTCGGTCCTCAACGTGAAGCTG
TGGACCATTTACCTCAACTACATCCGGCGCCGCAACGACCTGACCAATGATTCATCCGGATCCGCCAGACGGACC
GTGGCCCAGTCGTACGACTTCGTCATCGACAACATCGGTGTCGACCGAGACTCGGGAAACATCTGGCAAGATTAC
ATCAGTTTCGTCAAAAGCGGCCCTGGCCAGGTCGGCGGCACCGGCTGGCAGGATCAGCAGAAGATGGATCAGCTG
CGGAAAGCGTATCAGCGTGCCATCACCGTGCCCATGTTGACGGTGAACACCATGTGGAAAGAGTATGACCAGTTC
GAGATGGCTCTCAACAAAGTGACTGGCCGCAAGTTCATCCAGGAAAGGTCGCCTGGCTACATGTCGGCCAAGAGC
GGCAACATTGCCCTCGACAACATGACGCGCCACCTGAAGCGGACCAACCTTCCTCGGCTGCCGCCGGCACCCGGC
TTCGACGGCGACGAGGATTTCCGGAACCAGGTTGAGCTGTGGAAGAAGTGGATCGCCTGGGAGAAGGAAGATCCG
CTGGTGCTCAAGGACGACGAACCCCACGTGTTCAAGCAGAGAGTCGTATACTGTTACAAGCAGGCGCTGATGGCC
TTGCGATTCTGGCCCGAGATCTGGGTCGACGCGGCCACCTGGTGCCTGGAGAACGACGTGCGCGACGGCGACAAC
AAGCCCGTGGGGACGGAGATGCTCCTGCAGGGCATCGCGGCCAACCCGGAAAGCGTCTTGCTCGCCTTCAAGCAC
GCCGACCACATCGAGGCCCACTACCCCGAAAAGGAGGGGGACAAGTCGGAGTACGCCAAGGCCGTTCGACAGCCG
TACGACGCCGTGCTCGAAACGCTCTACAAGATGGGCGACAAGGTCAAGGAACATGAGAAGCTCGAGGTGAGCGCG
CTGAAGCTGGCAGCCGCACAGGGGCCCTCGATGCAGGAGTCGATCGAGCCGATCGACGACGACGACGACGACGAC
GACGACGACGATGAAGAGAAGAAGAAGAAGAAGAAGGAGAAAAAGTCGCCGATGGAGGAGCGCATAGCGGCGATC
CAGAACGCCCACGCTGCCGAATCGCAGCTGCTGTCCCGGACCATCTCGTACGTCTGGATCGCCTTGGCCCGCGCC
ATGCGACGCATCCAGGGCAAGGGAAACCAGAGCGAGAGCGGTCTGCGGAAGGTCTTCACCGACGCCCGCCAAAAG
GGGCGCCTCACGAGCGACGTGTACGTCGCCGTGGCCCTGCTGGAGTCGGTGGTATACAAGGATCCGGTGGGGTCC
AAAATCTTCGAGCGCGGCGCGCGCCTGTTCCCCAATGACGAGGGCTTCATGATAGAGTACATCAAGTTTCTCCAC
GCTAAGGACGACACCACGAATGCTCGCGTTGTTTTCGAGACTTGTGCCAACCGGCTCGTCTCCAAACCGGAGACG
CTGCACAAGGCAAAGCCTCTCTACGCCTACTTCCACAAGTACGAGTCGCAGTACGGCGAGCTGTCGCAGATCTCG
AAGCTGGAGGAGAGGATGGCGGAGCTGTTCCCCAAGGACCCCAAGCTCAGCTACTTCACGGCGCGCTACTCGTCC
GACAAGTTCGATCCGGTGGCGGCCCCGATCATCATCTCCAAAGCGGCGCAGATGCGGCCGAAGCTGGGCATCCCG
ACCATCGAGCAGCCCGTCTCGGCGCGCAACAGCGTGCCGCCGGCGAGACAGGAACAGAGCCCGCGTCCGCAGTAC
GTGCGGGCGACGGCGTCTCCGAAGCGGCCGTTCGGCGTCGACGAGGAGGATCTGAACCCCCCCAAGAGGCTGGCT
AGGGGCGCATCGCCTCTCAAGGGGGCGGCGGGCCGTCGGCTCGACCAGCAGCGGCGCAACCAGGCGTCGGCCCTG
CACCGCGACATCACCTTCCTGCTCGGCATCCTGCCCCCGGCGCACAGCTACGACGCGCAGAGGCTCAACCCGGCC
GCCATGACCTCGCTCCTCCGCGACATGCCCCTCCCGGACTACAGCACCTGGAGGGCCAAGACGGGCGGGCAGTAC
CGGACCCCCGTGCTCGGCCACGTGCGGCAGACTTCGGGAGACTTCGGCGGCCGACCGATGAGCCCGTACGGCCGC
GTCGCGTCGGGGGCCAGCGTCTACCGCAGCTCGCCGCTGCGCACGGAGAGCGGGGGCGCGTACGCCGGCAACCCG
TACGCCGGCGCCCCGGAGGCCGGCGCAGTGCCTTCGGTCTGGCCGGCGCTGTCGGGCGTGCATGGCGGAGGCTCC
GTGCCAGGCCCGCCCGGACAGTACGGCGGCTTTCGGTTTCAATGA
Transcript >Hirsu2|47
ATGGCCTCCGACGACGTGACGTGGGAAGGGGGTGAATACGCCGCCACCGATGAAGGTCAGGCTCAGACGAGCGAC
GAGCAAGCCGATGCCGTCGCGGACGACACCTCGCCGGCCGACGATGCGGCTGAAAACGATGATGACGCGGACGAC
GGCGCAGATTACGACCCCGAGTCCGTGGCCTTTGACACGAGTCCCTCGGCACCTGACCAAGCCGCCGCCCCTTCC
GCCGCGCCGCAACGCTCGGCACCTCCTAAACCTAAGATGTCGGGAGGCTTCCTCGTTGAGGTATCGGACGACGAC
GAGGAGGAGGAAGAAGAAGAAGAAGAAGAGGAGGAGGAGGAGGAGGAGGAGGGGGAGGAGGGAGACAATGACGCC
CCGAAAAACGCAGAACCACCAGTCCAAGACCAGGCGACTCCCGTTAAAAACGGAGTTTCGTCTGCGCCTCCGGCA
GACAAATCCCCTCCTGTGCCACAAGCAGCTCCGAGCCTCGATGCCGTCTCGCTCCTCGAAGTGCGCATCAAGGAG
GATCCCCGAGGAGACTTGAACGCATGGCTGAGCCTCGTGGCCGAGCACAAGCGTCGCGGCAGGATTGACGACGTA
CGGAGTGTATACAGTCGATTTCTCGAAGTCTTTCCGCAAGCAGCCGATATCTGGGTGGAGTGGATAGAGATGGAG
CTCAACATGGACAACTTCGTGGAGGCCGAGAGGTTGTTTGGCCGAAGCCTCATGTCGGTCCTCAACGTGAAGCTG
TGGACCATTTACCTCAACTACATCCGGCGCCGCAACGACCTGACCAATGATTCATCCGGATCCGCCAGACGGACC
GTGGCCCAGTCGTACGACTTCGTCATCGACAACATCGGTGTCGACCGAGACTCGGGAAACATCTGGCAAGATTAC
ATCAGTTTCGTCAAAAGCGGCCCTGGCCAGGTCGGCGGCACCGGCTGGCAGGATCAGCAGAAGATGGATCAGCTG
CGGAAAGCGTATCAGCGTGCCATCACCGTGCCCATGTTGACGGTGAACACCATGTGGAAAGAGTATGACCAGTTC
GAGATGGCTCTCAACAAAGTGACTGGCCGCAAGTTCATCCAGGAAAGGTCGCCTGGCTACATGTCGGCCAAGAGC
GGCAACATTGCCCTCGACAACATGACGCGCCACCTGAAGCGGACCAACCTTCCTCGGCTGCCGCCGGCACCCGGC
TTCGACGGCGACGAGGATTTCCGGAACCAGGTTGAGCTGTGGAAGAAGTGGATCGCCTGGGAGAAGGAAGATCCG
CTGGTGCTCAAGGACGACGAACCCCACGTGTTCAAGCAGAGAGTCGTATACTGTTACAAGCAGGCGCTGATGGCC
TTGCGATTCTGGCCCGAGATCTGGGTCGACGCGGCCACCTGGTGCCTGGAGAACGACGTGCGCGACGGCGACAAC
AAGCCCGTGGGGACGGAGATGCTCCTGCAGGGCATCGCGGCCAACCCGGAAAGCGTCTTGCTCGCCTTCAAGCAC
GCCGACCACATCGAGGCCCACTACCCCGAAAAGGAGGGGGACAAGTCGGAGTACGCCAAGGCCGTTCGACAGCCG
TACGACGCCGTGCTCGAAACGCTCTACAAGATGGGCGACAAGGTCAAGGAACATGAGAAGCTCGAGGTGAGCGCG
CTGAAGCTGGCAGCCGCACAGGGGCCCTCGATGCAGGAGTCGATCGAGCCGATCGACGACGACGACGACGACGAC
GACGACGACGATGAAGAGAAGAAGAAGAAGAAGAAGGAGAAAAAGTCGCCGATGGAGGAGCGCATAGCGGCGATC
CAGAACGCCCACGCTGCCGAATCGCAGCTGCTGTCCCGGACCATCTCGTACGTCTGGATCGCCTTGGCCCGCGCC
ATGCGACGCATCCAGGGCAAGGGAAACCAGAGCGAGAGCGGTCTGCGGAAGGTCTTCACCGACGCCCGCCAAAAG
GGGCGCCTCACGAGCGACGTGTACGTCGCCGTGGCCCTGCTGGAGTCGGTGGTATACAAGGATCCGGTGGGGTCC
AAAATCTTCGAGCGCGGCGCGCGCCTGTTCCCCAATGACGAGGGCTTCATGATAGAGTACATCAAGTTTCTCCAC
GCTAAGGACGACACCACGAATGCTCGCGTTGTTTTCGAGACTTGTGCCAACCGGCTCGTCTCCAAACCGGAGACG
CTGCACAAGGCAAAGCCTCTCTACGCCTACTTCCACAAGTACGAGTCGCAGTACGGCGAGCTGTCGCAGATCTCG
AAGCTGGAGGAGAGGATGGCGGAGCTGTTCCCCAAGGACCCCAAGCTCAGCTACTTCACGGCGCGCTACTCGTCC
GACAAGTTCGATCCGGTGGCGGCCCCGATCATCATCTCCAAAGCGGCGCAGATGCGGCCGAAGCTGGGCATCCCG
ACCATCGAGCAGCCCGTCTCGGCGCGCAACAGCGTGCCGCCGGCGAGACAGGAACAGAGCCCGCGTCCGCAGTAC
GTGCGGGCGACGGCGTCTCCGAAGCGGCCGTTCGGCGTCGACGAGGAGGATCTGAACCCCCCCAAGAGGCTGGCT
AGGGGCGCATCGCCTCTCAAGGGGGCGGCGGGCCGTCGGCTCGACCAGCAGCGGCGCAACCAGGCGTCGGCCCTG
CACCGCGACATCACCTTCCTGCTCGGCATCCTGCCCCCGGCGCACAGCTACGACGCGCAGAGGCTCAACCCGGCC
GCCATGACCTCGCTCCTCCGCGACATGCCCCTCCCGGACTACAGCACCTGGAGGGCCAAGACGGGCGGGCAGTAC
CGGACCCCCGTGCTCGGCCACGTGCGGCAGACTTCGGGAGACTTCGGCGGCCGACCGATGAGCCCGTACGGCCGC
GTCGCGTCGGGGGCCAGCGTCTACCGCAGCTCGCCGCTGCGCACGGAGAGCGGGGGCGCGTACGCCGGCAACCCG
TACGCCGGCGCCCCGGAGGCCGGCGCAGTGCCTTCGGTCTGGCCGGCGCTGTCGGGCGTGCATGGCGGAGGCTCC
GTGCCAGGCCCGCCCGGACAGTACGGCGGCTTTCGGTTTCAATGA
Gene >Hirsu2|47
ATGGCCTCCGACGACGTGACGTGGGAAGGGGGTGAATACGCCGCCACCGATGAAGGTCAGGCTCAGACGAGCGAC
GAGCAAGCCGATGCCGTCGCGGACGACACCTCGCCGGCCGACGATGCGGCTGAAAACGATGATGACGCGGACGAC
GGCGCAGATTACGACCCCGAGTCCGTGGCCTTTGACACGAGTCCCTCGGCACCTGACCAAGCCGCCGCCCCTTCC
GCCGCGCCGCAACGCTCGGCACCTCCTAAACCTAAGATGTCGGGAGGCTTCCTCGTTGAGGTATCGGACGACGAC
GAGGAGGAGGAAGAAGAAGAAGAAGAAGAGGAGGAGGAGGAGGAGGAGGAGGGGGAGGAGGGAGACAATGACGCC
CCGAAAAACGCAGAACCACCAGTCCAAGACCAGGCGACTCCCGTTAAAAACGGAGTTTCGTCTGCGCCTCCGGCA
GACAAATCCCCTCCTGTGCCACAAGCAGCTCCGAGCCTCGATGCCGTCTCGCTCCTCGAAGTGCGCATCAAGGAG
GATCCCCGAGGAGACTTGAACGCATGGCTGAGCCTCGTGGCCGAGCACAAGCGTCGCGGCAGGATTGACGACGTA
CGGAGTGTATACAGTCGATTTCTCGAAGTCTTTCCGCAAGCAGTAAGCCCCCCCCCGTTGCCTTGACCCGTGAAT
GTTTCCCCCGAAATTGAAAGTCGGCTTATGCGGGCCCGTAACCTTCAGGCCGATATCTGGGTGGAGTGGATAGAG
ATGGAGCTCAACATGGACAACTTCGTGGAGGCCGAGAGGTTGTTTGGCCGAAGCCTCATGTCGGTCCTCAACGTG
AAGCTGTGGACCATTTACCTCAACTACATCCGGCGCCGCAACGACCTGACCAATGATTCATCCGGATCCGCCAGA
CGGACCGTGGCCCAGTCGTACGACTTCGTCATCGACAACATCGGTGTCGACCGAGACTCGGGAAACATCTGGCAA
GATTACATCAGTTTCGTCAAAAGCGGCCCTGGCCAGGTCGGCGGCACCGGCTGGCAGGATCAGCAGAAGATGGAT
CAGCTGCGGAAAGCGTATCAGCGTGCCATCACCGTGCCCATGTTGACGGTGAACACCATGTGGAAAGAGTATGAC
CAGTTCGAGATGGCTCTCAACAAAGTGACTGTTCGTGACGCCCCTGCTTCCCCTCCATTTTCGCTCGGCTGACGG
GAAAAAAAAAACACTCGCAGGGCCGCAAGTTCATCCAGGAAAGGTCGCCTGGCTACATGTCGGCCAAGAGCGGCA
ACATTGCCCTCGACAACATGACGCGCCACCTGAAGCGGACCAACCTTCCTCGGCTGCCGCCGGCACCCGGCTTCG
ACGGCGACGAGGATTTCCGGAACCAGGTTGAGCTGTGGAAGAAGTGGATCGCCTGGGAGAAGGAAGATCCGCTGG
TGCTCAAGGACGACGAACCCCACGTGTTCAAGCAGAGAGTCGTATACTGTTACAAGCAGGCGCTGATGGCCTTGC
GATTCTGGCCCGAGATCTGGGTCGACGCGGCCACCTGGTGCCTGGAGAACGACGTGCGCGACGGCGACAACAAGC
CCGTGGGGACGGAGATGCTCCTGCAGGGCATCGCGGCCAACCCGGAAAGCGTCTTGCTCGCCTTCAAGCACGCCG
ACCACATCGAGGCCCACTACCCCGAAAAGGAGGGGGACAAGTCGGAGTACGCCAAGGCCGTTCGACAGCCGTACG
ACGCCGTGCTCGAAACGCTCTACAAGATGGGCGACAAGGTCAAGGAACATGAGAAGCTCGAGGTGAGCGCGCTGA
AGCTGGCAGCCGCACAGGGGCCCTCGATGCAGGAGTCGATCGAGCCGATCGACGACGACGACGACGACGACGACG
ACGACGATGAAGAGAAGAAGAAGAAGAAGAAGGAGAAAAAGTCGCCGATGGAGGAGCGCATAGCGGCGATCCAGA
ACGCCCACGCTGCCGAATCGCAGCTGCTGTCCCGGACCATCTCGTACGTCTGGATCGCCTTGGCCCGCGCCATGC
GACGCATCCAGGGCAAGGGAAACCAGAGCGAGAGCGGTCTGCGGAAGGTCTTCACCGACGCCCGCCAAAAGGGGC
GCCTCACGAGCGACGTGTACGTCGCCGTGGCCCTGCTGGAGTCGGTGGTATACAAGGATCCGGTGGGGTCCAAAA
TCTTCGAGCGCGGCGCGCGCCTGTTCCCCAATGACGAGGGCTTCATGATAGAGTACATCAAGTTTCTCCACGCTA
AGGACGACACCACGAGTGAGTCTCTTTTCCCCCACATGCAGCCTCGACGGCTACTGCATTGTCTCGGCCTGCTGG
GTGGGTGCTGACTGTGTGGACGCAGATGCTCGCGTTGTTTTCGAGACTTGTGCCAACCGGCTCGTCTCCAAACCG
GAGACGCTGCACAAGGCAAAGCCTCTCTACGCCTACTTCCACAAGTACGAGTCGCAGTACGGCGAGCTGTCGCAG
ATCTCGAAGCTGGAGGAGAGGATGGCGGAGCTGTTCCCCAAGGACCCCAAGCTCAGCTACTTCACGGCGCGCTAC
TCGTCCGACAAGTTCGATCCGGTGGCGGCCCCGATCATCATCTCCAAAGCGGCGCAGATGCGGCCGAAGCTGGGC
ATCCCGACCATCGAGCAGCCCGTCTCGGCGCGCAACAGCGTGCCGCCGGCGAGACAGGAACAGAGCCCGCGTCCG
CAGTACGTGCGGGCGACGGCGTCTCCGAAGCGGCCGTTCGGCGTCGACGAGGAGGATCTGAACCCCCCCAAGAGG
CTGGCTAGGGGCGCATCGCCTCTCAAGGGGGCGGCGGGCCGTCGGCTCGACCAGCAGCGGCGCAACCAGGCGTCG
GCCCTGCACCGCGACATCACCTTCCTGCTCGGCATCCTGCCCCCGGCGCACAGCTACGACGCGCAGAGGCTCAAC
CCGGCCGCCATGACCTCGCTCCTCCGCGACATGCCCCTCCCGGACTACAGCACCTGGAGGGCCAAGACGGGCGGG
CAGTACCGGACCCCCGTGCTCGGCCACGTGCGGCAGACTTCGGGAGACTTCGGCGGCCGACCGATGAGCCCGTAC
GGCCGCGTCGCGTCGGGGGCCAGCGTCTACCGCAGCTCGCCGCTGCGCACGGAGAGCGGGGGCGCGTACGCCGGC
AACCCGTACGCCGGCGCCCCGGAGGCCGGCGCAGTGCCTTCGGTCTGGCCGGCGCTGTCGGGCGTGCATGGCGGA
GGCTCCGTGCCAGGCCCGCCCGGACAGTACGGCGGCTTTCGGTTTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail