Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4697
Gene name
LocationContig_238:59..539
Strand+
Gene length (bp)480
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 3.5E-10 43 131
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.2E-05 39 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 1 157 3.0E-27
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 18 153 7.0E-24
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 78 146 1.0E-16
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 14 142 3.0E-09
sp|Q9JIY7|NAT8_MOUSE N-acetyltransferase 8 OS=Mus musculus GN=Nat8 PE=1 SV=1 21 139 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q18B70|ATSE_PEPD6 Acetyltransferase CD1211 OS=Peptoclostridium difficile (strain 630) GN=CD630_12110 PE=3 SV=1 1 157 3.0E-27
sp|O94340|YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.07c PE=3 SV=1 18 153 7.0E-24
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 78 146 1.0E-16
sp|Q8CHQ9|CMLO2_MOUSE Probable N-acetyltransferase CML2 OS=Mus musculus GN=Cml2 PE=1 SV=1 14 142 3.0E-09
sp|Q9JIY7|NAT8_MOUSE N-acetyltransferase 8 OS=Mus musculus GN=Nat8 PE=1 SV=1 21 139 8.0E-09
sp|Q54GF2|Y0199_DICDI Uncharacterized N-acetyltransferase DDB_G0290199 OS=Dictyostelium discoideum GN=DDB_G0290199 PE=3 SV=1 4 60 3.0E-08
sp|P85118|CMLO2_RAT Probable N-acetyltransferase CML2 OS=Rattus norvegicus GN=Cml2 PE=3 SV=1 19 142 3.0E-08
sp|Q9QXT3|NAT8_RAT N-acetyltransferase 8 OS=Rattus norvegicus GN=Nat8 PE=1 SV=1 21 139 5.0E-08
sp|Q9JIZ0|CMLO1_MOUSE Probable N-acetyltransferase CML1 OS=Mus musculus GN=Cml1 PE=1 SV=1 41 136 6.0E-08
sp|Q9QXS7|CMLO5_RAT Probable N-acetyltransferase CML5 OS=Rattus norvegicus GN=Cml5 PE=2 SV=2 21 154 1.0E-07
sp|E0CYC6|NAT8B_MOUSE N-acetyltransferase 8B OS=Mus musculus GN=Nat8b PE=1 SV=1 41 142 1.0E-07
sp|Q9QXT4|CMLO1_RAT Probable N-acetyltransferase CML1 OS=Rattus norvegicus GN=Cml1 PE=2 SV=1 39 139 3.0E-07
sp|Q9JIY6|CMLO6_RAT Probable N-acetyltransferase CML6 OS=Rattus norvegicus GN=Cml6 PE=2 SV=1 21 142 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4697
MAAVRACFGAYTAWLDEDISFQNYAAELGGLPGQYAAAAGGALLLAVNAGGQILGCVAMRPLTVGPRYAAGRRAG
GARVCEMKRLFVYPEARGRRVSRALVRELVRTAREAGYDEMVLDTMARMRAAIGLYASEAFVPTEPYCFNPLDGV
LFFSKRLDA*
Coding >Hirsu2|4697
ATGGCCGCCGTCCGCGCATGCTTCGGCGCCTACACGGCCTGGCTGGACGAGGACATCTCCTTCCAGAACTACGCG
GCCGAGCTGGGCGGGCTACCGGGCCAGTACGCGGCCGCGGCTGGCGGCGCCCTGCTGCTGGCCGTCAACGCCGGC
GGCCAGATCCTGGGCTGCGTCGCCATGCGCCCGCTGACGGTCGGGCCCCGGTACGCGGCCGGGCGGCGCGCGGGC
GGCGCGCGCGTGTGCGAGATGAAACGCCTGTTCGTCTACCCCGAGGCCCGCGGCCGGCGGGTCTCGAGGGCTCTG
GTCCGGGAGCTGGTCCGGACGGCGCGCGAGGCCGGCTACGACGAGATGGTCCTCGACACCATGGCCCGGATGCGC
GCGGCCATCGGGCTGTACGCGTCGGAGGCGTTTGTGCCGACCGAGCCGTACTGCTTCAACCCGCTCGACGGCGTT
CTCTTCTTCTCCAAAAGGCTAGATGCCTAG
Transcript >Hirsu2|4697
ATGGCCGCCGTCCGCGCATGCTTCGGCGCCTACACGGCCTGGCTGGACGAGGACATCTCCTTCCAGAACTACGCG
GCCGAGCTGGGCGGGCTACCGGGCCAGTACGCGGCCGCGGCTGGCGGCGCCCTGCTGCTGGCCGTCAACGCCGGC
GGCCAGATCCTGGGCTGCGTCGCCATGCGCCCGCTGACGGTCGGGCCCCGGTACGCGGCCGGGCGGCGCGCGGGC
GGCGCGCGCGTGTGCGAGATGAAACGCCTGTTCGTCTACCCCGAGGCCCGCGGCCGGCGGGTCTCGAGGGCTCTG
GTCCGGGAGCTGGTCCGGACGGCGCGCGAGGCCGGCTACGACGAGATGGTCCTCGACACCATGGCCCGGATGCGC
GCGGCCATCGGGCTGTACGCGTCGGAGGCGTTTGTGCCGACCGAGCCGTACTGCTTCAACCCGCTCGACGGCGTT
CTCTTCTTCTCCAAAAGGCTAGATGCCTAG
Gene >Hirsu2|4697
ATGGCCGCCGTCCGCGCATGCTTCGGCGCCTACACGGCCTGGCTGGACGAGGACATCTCCTTCCAGAACTACGCG
GCCGAGCTGGGCGGGCTACCGGGCCAGTACGCGGCCGCGGCTGGCGGCGCCCTGCTGCTGGCCGTCAACGCCGGC
GGCCAGATCCTGGGCTGCGTCGCCATGCGCCCGCTGACGGTCGGGCCCCGGTACGCGGCCGGGCGGCGCGCGGGC
GGCGCGCGCGTGTGCGAGATGAAACGCCTGTTCGTCTACCCCGAGGCCCGCGGCCGGCGGGTCTCGAGGGCTCTG
GTCCGGGAGCTGGTCCGGACGGCGCGCGAGGCCGGCTACGACGAGATGGTCCTCGACACCATGGCCCGGATGCGC
GCGGCCATCGGGCTGTACGCGTCGGAGGCGTTTGTGCCGACCGAGCCGTACTGCTTCAACCCGCTCGACGGCGTT
CTCTTCTTCTCCAAAAGGCTAGATGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail