Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4687
Gene name
LocationContig_2374:1405..1999
Strand-
Gene length (bp)594
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 1.8E-13 6 133

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 66 22
3 79 101 22
4 116 138 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4687
MAIGSGILAIVHAVLAAFLVIELGLTSYVVSRTNIGWWSNTPSQFSFMLFASIWSLLALIYLALAPRFFERLYHG
LVALGLLVITTLFWFGGSIAMAAFVGVPDCRGRFCSTVQSAQAAVAFGFFIWAIFTFLSVVEGMASLKGRARADT
PARKPGQPYPGV*
Coding >Hirsu2|4687
ATGGCTATCGGATCCGGCATCCTCGCCATCGTCCATGCCGTCCTCGCCGCCTTCCTCGTCATCGAACTCGGCCTG
ACGAGCTATGTCGTCAGCAGGACCAACATCGGCTGGTGGAGCAACACGCCGTCGCAGTTCAGCTTCATGCTCTTC
GCCAGCATCTGGTCCCTCCTCGCCCTCATCTACCTCGCCCTGGCCCCGCGCTTCTTCGAGCGCCTCTACCACGGC
CTCGTCGCCCTCGGCCTCCTCGTCATCACCACCCTCTTCTGGTTCGGCGGCTCCATCGCCATGGCCGCCTTCGTC
GGTGTCCCCGACTGCCGCGGCCGCTTCTGCTCCACCGTCCAGAGCGCCCAGGCCGCTGTCGCCTTCGGCTTCTTC
ATCTGGGCCATCTTCACCTTCCTCTCTGTCGTCGAGGGCATGGCCTCGCTCAAGGGCCGCGCCCGCGCCGACACC
CCCGCCCGCAAGCCCGGCCAGCCCTACCCGGGCGTTTAA
Transcript >Hirsu2|4687
ATGGCTATCGGATCCGGCATCCTCGCCATCGTCCATGCCGTCCTCGCCGCCTTCCTCGTCATCGAACTCGGCCTG
ACGAGCTATGTCGTCAGCAGGACCAACATCGGCTGGTGGAGCAACACGCCGTCGCAGTTCAGCTTCATGCTCTTC
GCCAGCATCTGGTCCCTCCTCGCCCTCATCTACCTCGCCCTGGCCCCGCGCTTCTTCGAGCGCCTCTACCACGGC
CTCGTCGCCCTCGGCCTCCTCGTCATCACCACCCTCTTCTGGTTCGGCGGCTCCATCGCCATGGCCGCCTTCGTC
GGTGTCCCCGACTGCCGCGGCCGCTTCTGCTCCACCGTCCAGAGCGCCCAGGCCGCTGTCGCCTTCGGCTTCTTC
ATCTGGGCCATCTTCACCTTCCTCTCTGTCGTCGAGGGCATGGCCTCGCTCAAGGGCCGCGCCCGCGCCGACACC
CCCGCCCGCAAGCCCGGCCAGCCCTACCCGGGCGTTTAA
Gene >Hirsu2|4687
ATGGCTATCGGATCCGGCATCCTCGCCATCGTCCATGCCGTCCTCGCCGCCTTCCTCGTCATCGAACTCGGCCTG
ACGAGCTATGGTAAGCCTCCTCCTCACATCATGTCCTTCTGTCTTCCCCTCCCCCTCTCTCTCTACGTTTCCCCA
TCTTCTGTTACATCTTTCTGACCGCTCCGAACAAAAACAGTCGTCAGCAGGACCAACATCGGCTGGTGGAGCAAC
ACGCCGTCGCAGTTCAGCTTCATGCTCTTCGCCAGCATCTGGTCCCTCCTCGCCCTCATCTACCTCGCCCTGGCC
CCGCGCTTCTTCGAGCGCCTCTACCACGGCCTCGTCGCCCTCGGCCTCCTCGTCATCACCACCCTCTTCTGGTTC
GGCGGCTCCATCGCCATGGCCGCCTTCGTCGGTGTCCCCGACTGCCGCGGCCGCTTCTGCTCCACCGTCCAGAGC
GCCCAGGCCGCTGTCGCCTTCGGCTTCTTCATCTGGGCCATCTTCACCTTCCTCTCTGTCGTCGAGGGCATGGCC
TCGCTCAAGGGCCGCGCCCGCGCCGACACCCCCGCCCGCAAGCCCGGCCAGCCCTACCCGGGCGTTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail