Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4683
Gene name
LocationContig_237:24363..26865
Strand+
Gene length (bp)2502
Transcript length (bp)1995
Coding sequence length (bp)1995
Protein length (aa) 665

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 137 159 22
2 169 186 17
3 230 252 22
4 262 284 22
5 297 319 22
6 329 351 22
7 364 386 22
8 550 572 22
9 579 601 22
10 611 633 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4683
MWSSKLCNPLLSPSTATGESERDMEKQPDEDRQPQSMASSSTMSSSSSSEQQPAPKLRIFASPLVRRPGVDAGKA
SSHDGLDGFDDRVVPPEDGMPEFKRYQEPTLLEIFFDLFFAANYNVFSETQKVTNHARFKAYVGYFCLLWLTWFL
VTLFDVRYVTDSIFSRLMRAVQLGVLVGFVVVAPHFDPTHQKATTMRAMSLILCVSRATLAIEYGSTLLHLRRYK
KARRPIYLQIGLHVVAAAVYLGIAFRFREEERSRIYMTWYFFSGGEAILSLLLSNLSPVLSLTHTHLMKRIALLT
VMILGDGVVQVAKEVVIIVKKPSAWDSATIGLITAAAATIYFMFLIYFDWMRARFHLPALRQQLWVGLHLALHLA
LVLHLHVFSQWILWYKIWSRFDGIADFADPSDEPGIGNSTSQQVADRLEGSIRDFFGDFKPSQPDTMQIIDSALA
NISSMPDAFWPVVKQAQDSPGSEYYDVFDRAGFVDVWEDYYTAFLAIVATLDSSLFSAYEIDLDQDDIKKKEVRS
PDDEQSGLWQVAIPEKGFDRCRLAFAYGYVSAGVTIFLLATLLIILRTLPRKVWPLIRLAIIYALALGTGLVALL
WFNETLLEAFLTGPWVLPTLTLVWGTMLVLTHINGEGVKRNKHRFTAINHTVGRLAHRRNEAFR*
Coding >Hirsu2|4683
ATGTGGTCGTCGAAGCTGTGCAACCCGCTTCTCTCGCCATCGACCGCCACCGGCGAGAGCGAGCGGGACATGGAG
AAGCAGCCGGACGAGGACCGGCAGCCGCAAAGCATGGCGTCATCTTCGACCATGTCGTCGTCGTCGTCGTCGGAG
CAGCAGCCGGCGCCGAAGCTGCGCATCTTCGCCAGCCCGCTCGTGCGCCGGCCCGGCGTCGACGCCGGCAAGGCC
AGCAGCCACGACGGCCTCGACGGCTTCGACGATCGAGTCGTCCCGCCCGAGGACGGCATGCCCGAGTTCAAGCGC
TACCAGGAGCCGACCCTGCTGGAGATCTTCTTCGACCTGTTCTTCGCCGCCAACTACAACGTCTTCTCCGAGACG
CAAAAGGTGACGAACCACGCGCGCTTCAAGGCCTACGTCGGATACTTCTGCCTGCTGTGGTTGACCTGGTTTCTC
GTCACGCTCTTCGACGTCCGCTACGTCACCGATAGCATCTTCTCCCGACTGATGCGGGCCGTCCAGCTGGGCGTG
CTGGTCGGCTTCGTCGTCGTCGCGCCTCACTTCGATCCGACGCACCAGAAGGCGACGACGATGCGAGCCATGTCC
CTCATCCTCTGCGTCTCGCGCGCGACGCTGGCCATCGAGTACGGCAGCACGCTGCTGCACCTCCGGCGCTATAAA
AAGGCCCGGCGCCCGATCTACCTGCAGATCGGCCTGCACGTCGTCGCGGCGGCCGTCTACCTCGGCATCGCCTTT
CGCTTCCGTGAGGAGGAGCGCAGCCGGATCTACATGACCTGGTACTTCTTCTCGGGCGGCGAGGCCATCCTCAGC
CTGCTGCTGTCCAACCTGTCGCCCGTGCTCAGCCTGACGCACACGCACCTGATGAAGCGGATCGCGCTGCTGACC
GTCATGATCCTCGGTGATGGCGTCGTCCAGGTGGCCAAGGAGGTCGTCATCATCGTCAAGAAGCCGTCGGCCTGG
GACTCGGCCACCATCGGCCTCATCACGGCCGCGGCCGCAACCATCTACTTCATGTTCCTCATCTACTTCGACTGG
ATGCGGGCGCGCTTCCACCTGCCGGCGCTGCGGCAGCAGCTCTGGGTCGGGCTGCATCTGGCGCTGCACCTGGCG
CTGGTGCTGCACCTGCACGTCTTCTCGCAGTGGATCCTGTGGTATAAGATCTGGTCGCGCTTCGACGGCATCGCC
GACTTCGCCGACCCGTCCGACGAGCCCGGCATCGGCAACTCGACCAGCCAGCAGGTGGCGGACCGTCTCGAGGGC
TCCATCCGCGACTTCTTCGGCGACTTCAAGCCCAGCCAGCCGGACACGATGCAGATCATCGACTCCGCCCTCGCC
AACATCAGCAGCATGCCCGACGCCTTCTGGCCCGTCGTCAAGCAGGCCCAGGACAGCCCCGGCTCCGAGTACTAC
GACGTCTTCGACCGGGCCGGCTTCGTCGACGTCTGGGAGGACTACTATACCGCCTTCCTCGCCATCGTCGCCACC
CTCGACAGCTCGCTCTTCTCCGCCTACGAGATCGACCTGGACCAGGACGACATCAAGAAGAAGGAGGTCCGCTCG
CCCGACGACGAGCAGAGCGGCCTGTGGCAGGTCGCCATCCCGGAGAAGGGCTTCGACCGCTGCCGCCTCGCCTTT
GCCTACGGATACGTCTCCGCCGGCGTCACCATCTTCCTGCTCGCCACCCTGCTCATCATCCTGCGCACGCTGCCG
CGCAAGGTCTGGCCCCTGATCCGCCTGGCCATCATCTATGCCTTGGCTCTCGGCACCGGCCTCGTCGCCCTGCTC
TGGTTCAACGAGACGCTCCTCGAAGCCTTCCTGACAGGGCCCTGGGTCCTGCCTACCCTCACCCTCGTCTGGGGA
ACCATGCTGGTCCTGACCCATATCAACGGCGAGGGCGTCAAGCGGAACAAACACCGCTTCACCGCCATCAACCAC
ACCGTCGGACGGCTCGCCCATCGCCGCAACGAAGCCTTTCGATAG
Transcript >Hirsu2|4683
ATGTGGTCGTCGAAGCTGTGCAACCCGCTTCTCTCGCCATCGACCGCCACCGGCGAGAGCGAGCGGGACATGGAG
AAGCAGCCGGACGAGGACCGGCAGCCGCAAAGCATGGCGTCATCTTCGACCATGTCGTCGTCGTCGTCGTCGGAG
CAGCAGCCGGCGCCGAAGCTGCGCATCTTCGCCAGCCCGCTCGTGCGCCGGCCCGGCGTCGACGCCGGCAAGGCC
AGCAGCCACGACGGCCTCGACGGCTTCGACGATCGAGTCGTCCCGCCCGAGGACGGCATGCCCGAGTTCAAGCGC
TACCAGGAGCCGACCCTGCTGGAGATCTTCTTCGACCTGTTCTTCGCCGCCAACTACAACGTCTTCTCCGAGACG
CAAAAGGTGACGAACCACGCGCGCTTCAAGGCCTACGTCGGATACTTCTGCCTGCTGTGGTTGACCTGGTTTCTC
GTCACGCTCTTCGACGTCCGCTACGTCACCGATAGCATCTTCTCCCGACTGATGCGGGCCGTCCAGCTGGGCGTG
CTGGTCGGCTTCGTCGTCGTCGCGCCTCACTTCGATCCGACGCACCAGAAGGCGACGACGATGCGAGCCATGTCC
CTCATCCTCTGCGTCTCGCGCGCGACGCTGGCCATCGAGTACGGCAGCACGCTGCTGCACCTCCGGCGCTATAAA
AAGGCCCGGCGCCCGATCTACCTGCAGATCGGCCTGCACGTCGTCGCGGCGGCCGTCTACCTCGGCATCGCCTTT
CGCTTCCGTGAGGAGGAGCGCAGCCGGATCTACATGACCTGGTACTTCTTCTCGGGCGGCGAGGCCATCCTCAGC
CTGCTGCTGTCCAACCTGTCGCCCGTGCTCAGCCTGACGCACACGCACCTGATGAAGCGGATCGCGCTGCTGACC
GTCATGATCCTCGGTGATGGCGTCGTCCAGGTGGCCAAGGAGGTCGTCATCATCGTCAAGAAGCCGTCGGCCTGG
GACTCGGCCACCATCGGCCTCATCACGGCCGCGGCCGCAACCATCTACTTCATGTTCCTCATCTACTTCGACTGG
ATGCGGGCGCGCTTCCACCTGCCGGCGCTGCGGCAGCAGCTCTGGGTCGGGCTGCATCTGGCGCTGCACCTGGCG
CTGGTGCTGCACCTGCACGTCTTCTCGCAGTGGATCCTGTGGTATAAGATCTGGTCGCGCTTCGACGGCATCGCC
GACTTCGCCGACCCGTCCGACGAGCCCGGCATCGGCAACTCGACCAGCCAGCAGGTGGCGGACCGTCTCGAGGGC
TCCATCCGCGACTTCTTCGGCGACTTCAAGCCCAGCCAGCCGGACACGATGCAGATCATCGACTCCGCCCTCGCC
AACATCAGCAGCATGCCCGACGCCTTCTGGCCCGTCGTCAAGCAGGCCCAGGACAGCCCCGGCTCCGAGTACTAC
GACGTCTTCGACCGGGCCGGCTTCGTCGACGTCTGGGAGGACTACTATACCGCCTTCCTCGCCATCGTCGCCACC
CTCGACAGCTCGCTCTTCTCCGCCTACGAGATCGACCTGGACCAGGACGACATCAAGAAGAAGGAGGTCCGCTCG
CCCGACGACGAGCAGAGCGGCCTGTGGCAGGTCGCCATCCCGGAGAAGGGCTTCGACCGCTGCCGCCTCGCCTTT
GCCTACGGATACGTCTCCGCCGGCGTCACCATCTTCCTGCTCGCCACCCTGCTCATCATCCTGCGCACGCTGCCG
CGCAAGGTCTGGCCCCTGATCCGCCTGGCCATCATCTATGCCTTGGCTCTCGGCACCGGCCTCGTCGCCCTGCTC
TGGTTCAACGAGACGCTCCTCGAAGCCTTCCTGACAGGGCCCTGGGTCCTGCCTACCCTCACCCTCGTCTGGGGA
ACCATGCTGGTCCTGACCCATATCAACGGCGAGGGCGTCAAGCGGAACAAACACCGCTTCACCGCCATCAACCAC
ACCGTCGGACGGCTCGCCCATCGCCGCAACGAAGCCTTTCGATAG
Gene >Hirsu2|4683
ATGTGGTCGTCGAAGCTGTGCAACCCGCTTCTCTCGCCATCGACCGCCACCGGCGAGAGCGAGCGGGACATGGAG
AAGCAGCCGGACGAGGACCGGCAGCCGCAAAGCATGGCGTCATCTTCGACCATGTCGTCGTCGTCGTCGTCGGAG
CAGCAGCCGGCGCCGAAGCTGCGCATCTTCGCCAGCCCGCTCGTGCGCCGGCCCGGCGTCGACGCCGGCAAGGCC
AGCAGCCACGACGGCCTCGACGGCTTCGACGATCGAGTCGTCCCGCCCGAGGACGGCATGCCCGAGTTCAAGCGC
GTGCGTCTCGCCCTCCCGCCTCCCTTTTCGGCCTGAGTCTCACACGCCGGCGACTGCAGTACCAGGAGCCGACCC
TGCTGGAGATCTTCTTCGACCTGTTCTTCGCCGCCAACTACAACGTCTTCTCCGAGACGCAAAAGGTGACGAACC
ACGCGCGCTTCAAGGCCTACGTCGGATACTTCTGGTACGCCGCCTCCCGGTCTGCCGCACCCGCTCCCTACCGGA
GGGAACTGACACGCGTTGCAGCCTGCTGTGGTTGACCTGGTTTCTCGTCACGCTCTTCGACGTCCGCTACGTCAC
CGATAGCATCTTCTGTACGTTATGAGGCCGGCCGCCGCGCCTCGACCTTCAACCGCGATGATGGCTGACGACGGA
GAGCGACGCAGCCCGACTGATGCGGGCCGTCCAGCTGGGCGTGCTGGTCGGCTTCGTCGTCGTCGCGCCTCACTT
CGATCCGACGCACCAGAAGGCGACGACGATGCGAGCCATGTGTGCGTCCCCCCAGAACAACCCCCTCCCCCCTTT
TCTCCTCCTCCACTGACGACTTACATCGCCCTCCTCTCTCTCTGGCTCTCGATCGACAGCCCTCATCCTCTGCGT
CTCGCGCGCGACGCTGGCCATCGAGTACGGCAGCACGCTGCTGCACCTCCGGCGCTATAAAAAGGCCCGGCGCCC
GATCTACCTGCAGATCGGCCTGCACGTCGTCGCGGCGGCCGTCTACCTCGGCATCGCCTTTCGCTTCCGTGAGGA
GGAGCGCAGCCGGATCTACATGACCTGGTACTTCTTCTCGGGCGGCGAGGCCATCCTCAGCCTGCTGCTGTCCAA
CCTGTCGCCCGTGCTCAGCCTGACGCACACGCACCTGATGAAGCGGATCGCGCTGCTGACCGTCATGATCCTCGG
TGATGGCGTCGTCCAGGTGGCCAAGGAGGTCGTCATCATCGTCAAGAAGCCGTCGGCCTGGGGTAAGCAGCAGCA
TCCCCCCCCCTTTTCCGTTCCCCCCCTCCCCCCTTTTCCGCCCCCTTTTTTTTTCTCGCTCGCCTCTCGTACTTG
TCTTGTCTTTCTATCCTGTCTTCCGCGGCTCTCAAGAAACCGATGGGCTGAGCACAAATTCATACACGTCACAGA
CTCGGCCACCATCGGCCTCATCACGGCCGCGGCCGCAACCATCTACTTCATGTTCCTCATCTACTTCGACTGGAT
GCGGGCGCGCTTCCACCTGCCGGCGCTGCGGCAGCAGCTCTGGGTCGGGCTGCATCTGGCGCTGCACCTGGCGCT
GGTGCTGCACCTGCACGTCTTCTCGCAGTGGATCCTGTGGTATAAGATCTGGTCGCGCTTCGACGGCATCGCCGA
CTTCGCCGACCCGTCCGACGAGCCCGGCATCGGCAACTCGACCAGCCAGCAGGTGGCGGACCGTCTCGAGGGCTC
CATCCGCGACTTCTTCGGCGACTTCAAGCCCAGCCAGCCGGACACGATGCAGATCATCGACTCCGCCCTCGCCAA
CATCAGCAGCATGCCCGACGCCTTCTGGCCCGTCGTCAAGCAGGCCCAGGACAGCCCCGGCTCCGAGTACTACGA
CGTCTTCGACCGGGCCGGCTTCGTCGACGTCTGGGAGGACTACTATACCGCCTTCCTCGCCATCGTCGCCACCCT
CGACAGCTCGCTCTTCTCCGCCTACGAGATCGACCTGGACCAGGACGACATCAAGAAGAAGGAGGTCCGCTCGCC
CGACGACGAGCAGAGCGGCCTGTGGCAGGTCGCCATCCCGGAGAAGGGCTTCGACCGCTGCCGCCTCGCCGTAAG
TCACCGCTTCAACTTTACCTGACCTGCTCGACGAGCTGACGCAGACGGGCTCAGTTTGCCTACGGATACGTCTCC
GCCGGCGTCACCATCTTCCTGCTCGCCACCCTGCTCATCATCCTGCGCACGCTGCCGCGCAAGGTCTGGCCCCTG
ATCCGCCTGGCCATCATCTATGCCTTGGCTCTCGGCACCGGCCTCGTCGCCCTGCTCTGGTTCAACGAGACGCTC
CTCGAAGCCTTCCTGACAGGGCCCTGGGTCCTGCCTACCCTCACCCTCGTCTGGGGAACCATGCTGGTCCTGACC
CATATCAACGGCGAGGGCGTCAAGCGGAACAAACACCGCTTCACCGCCATCAACCACACCGTCGGACGGCTCGCC
CATCGCCGCAACGAAGCCTTTCGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail