Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4682
Gene name
LocationContig_237:17927..20713
Strand+
Gene length (bp)2786
Transcript length (bp)2622
Coding sequence length (bp)2622
Protein length (aa) 874

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 5.9E-36 148 548
PF06280 fn3_5 Fn3-like domain 3.9E-14 609 724
PF02225 PA PA domain 1.7E-06 387 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 145 651 6.0E-36
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 124 729 5.0E-25
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 124 729 2.0E-23
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 124 729 4.0E-23
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 124 737 8.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 145 651 6.0E-36
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 124 729 5.0E-25
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 124 729 2.0E-23
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 124 729 4.0E-23
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 124 737 8.0E-23
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 143 304 4.0E-18
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 150 336 8.0E-18
sp|P58099|C5AP_STRP1 C5a peptidase OS=Streptococcus pyogenes serotype M1 GN=scpA PE=3 SV=1 136 600 2.0E-16
sp|Q8NZ80|C5AP_STRP8 C5a peptidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=scpA PE=3 SV=1 136 600 2.0E-16
sp|Q5X9R0|C5AP_STRP6 C5a peptidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=scpA PE=3 SV=1 136 600 2.0E-16
sp|P0DD35|C5AP_STRPQ C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=scpA PE=3 SV=1 131 600 3.0E-16
sp|P0DD34|C5AP_STRP3 C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=scpA PE=3 SV=1 131 600 3.0E-16
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 141 306 7.0E-16
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 141 306 9.0E-16
sp|P15926|C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes GN=scpA PE=1 SV=1 136 600 3.0E-15
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 141 306 3.0E-15
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 144 304 6.0E-15
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 141 302 8.0E-15
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 141 302 8.0E-15
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 135 306 1.0E-14
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 125 275 2.0E-14
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 125 275 2.0E-14
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 137 321 1.0E-13
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 148 275 5.0E-13
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 137 321 2.0E-12
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 137 321 2.0E-12
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 137 321 2.0E-12
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 137 321 3.0E-12
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 153 313 2.0E-11
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 18 310 2.0E-11
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 151 331 7.0E-10
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 8 327 1.0E-09
sp|Q9FHA4|SBT19_ARATH Subtilisin-like protease SBT1.9 OS=Arabidopsis thaliana GN=SBT1.9 PE=2 SV=1 197 548 2.0E-09
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 137 302 2.0E-09
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 119 327 3.0E-09
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 199 542 3.0E-09
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 8 327 3.0E-09
sp|Q8L7D2|SBT4C_ARATH Subtilisin-like protease SBT4.12 OS=Arabidopsis thaliana GN=SBT4.12 PE=2 SV=1 153 693 4.0E-09
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 137 329 6.0E-09
sp|Q14703|MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens GN=MBTPS1 PE=1 SV=1 137 305 6.0E-09
sp|Q9LZS6|SBT4F_ARATH Subtilisin-like protease SBT4.15 OS=Arabidopsis thaliana GN=SBT4.15 PE=3 SV=1 151 314 7.0E-09
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 137 305 7.0E-09
sp|Q9LNU1|CRSP_ARATH CO(2)-response secreted protease OS=Arabidopsis thaliana GN=CRSP PE=2 SV=1 203 544 7.0E-09
sp|Q9WTZ3|MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus GN=Mbtps1 PE=1 SV=2 137 305 7.0E-09
sp|Q9Z2A8|MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus GN=MBTPS1 PE=1 SV=2 137 305 8.0E-09
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 147 302 1.0E-08
sp|Q9FIG1|SBT4B_ARATH Subtilisin-like protease SBT4.11 OS=Arabidopsis thaliana GN=SBT4.11 PE=2 SV=2 153 399 1.0E-08
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 8 327 1.0E-08
sp|Q9FGU3|SBT44_ARATH Subtilisin-like protease SBT4.4 OS=Arabidopsis thaliana GN=SBT4.4 PE=2 SV=1 153 544 1.0E-08
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 114 327 2.0E-08
sp|E4UZP9|SUB2_ARTGP Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 17 304 2.0E-08
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 123 302 4.0E-08
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 123 302 4.0E-08
sp|F4JA91|SBT45_ARATH Subtilisin-like protease SBT4.5 OS=Arabidopsis thaliana GN=SBT4.5 PE=3 SV=1 135 626 5.0E-08
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 148 302 5.0E-08
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 8 302 5.0E-08
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 8 302 5.0E-08
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 148 302 7.0E-08
sp|C5G168|SUB2_ARTOC Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 17 304 1.0E-07
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 137 304 1.0E-07
sp|Q9SA75|SBT21_ARATH Subtilisin-like protease SBT2.1 OS=Arabidopsis thaliana GN=SBT2.1 PE=2 SV=1 148 565 1.0E-07
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 138 301 2.0E-07
sp|P58502|TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 151 274 3.0E-07
sp|Q9FIM8|SBT4A_ARATH Subtilisin-like protease SBT4.10 OS=Arabidopsis thaliana GN=SBT4.10 PE=5 SV=1 153 303 3.0E-07
sp|C5PCX1|SUB7B_COCP7 Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 148 304 3.0E-07
sp|Q9ZSB1|SBT3A_ARATH Subtilisin-like protease SBT3.10 OS=Arabidopsis thaliana GN=SBT3.10 PE=3 SV=2 201 548 6.0E-07
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 142 303 7.0E-07
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 115 302 8.0E-07
sp|Q8W469|SIPL2_ARATH Signal peptide peptidase-like 2 OS=Arabidopsis thaliana GN=SPPL2 PE=2 SV=1 376 470 9.0E-07
sp|Q9LVJ1|SBT14_ARATH Subtilisin-like protease SBT1.4 OS=Arabidopsis thaliana GN=SBT1.4 PE=2 SV=1 120 546 9.0E-07
sp|O49607|SBT16_ARATH Subtilisin-like protease SBT1.6 OS=Arabidopsis thaliana GN=SBT1.6 PE=2 SV=1 191 544 1.0E-06
sp|Q9FIM6|SBT48_ARATH Subtilisin-like protease SBT4.8 OS=Arabidopsis thaliana GN=SBT4.8 PE=3 SV=1 153 303 1.0E-06
sp|Q9ZUF6|SBT18_ARATH Subtilisin-like protease SBT1.8 OS=Arabidopsis thaliana GN=SBT1.8 PE=2 SV=1 167 544 2.0E-06
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 148 303 2.0E-06
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 115 302 3.0E-06
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 123 302 3.0E-06
sp|P08594|AQL1_THEAQ Aqualysin-1 OS=Thermus aquaticus GN=pstI PE=1 SV=2 147 256 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0005618 cell wall Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0043170 macromolecule metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0030312 external encapsulating structure No
GO:0008233 peptidase activity No
GO:0044464 cell part No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4682
MVGRWLRSGASLLLAAPLHLAAADLIPGAYLFQLERHHDTAAFLSAVQTHGTIQMELKFELFNGASVQFNDLRNV
DRIASEIAALPVVKKMWPMQNYSQPDEGVKWVSAPIGDTKSSNLRARSVYEHEPFPAHAMTQVDRLHANGVTGRG
IKIAVIDSGVDYTHPALGGGCFGPGCLVARGYDFVGDAFDGSNTPHQDEDPMDCGGHGTHVAGIIAAQPGNMFGF
TGAAPGVTLAAYRVFGCRGGTRDDVLIAALNRAYEDGADIISLSLGSPSGWSEHPWSAAVSDVVAKGVACLVSAA
NDGEMGLFYASTAADGKRVTAIAAFENIVHHVLQYDISYTVDGGPSVTVGFVQGEPADWSNVSLPLWAGSFDVEA
PADGCAPLPSDAPDLKERIVLIRRGSCTFKEKINNARAKGARYILVYNNAPRAIELDLDIPALAGVGMVSAEAGH
AWIKLLAEGKKVVVDMVSYRDAKPHLINTPNREDGGALLEMNSWGPTWQMDVKPQFGAVGGTVLSTYPVKKGGYA
VWSGTSQACPQVAAIYALIAQVRGGRVDPGLFESLLSANADPQLFHNGKTFLPYLAPVAQQGGGIVRAYDAAYAT
TLLEPSSLSFNDTQGFLRTLNLTIKNTESRDITYTVSHVPAITMYTLQNGSITPQSFPNDVVHSPADLAFNGEER
LEVVVGGGDTRAIRVAPTPPQGLNADRLALWSGYIAVNGSDGSSLSIPYQGLTGSLQNATVLGRRGTWIAKSTDK
GPYDPVPTNTTFTLPRPGSSTANATLPSLRVELTLGSPLVLADVVAVAGARRGAAIGRMADFPQYWLPRLSFSVS
WNGTLSTGQYAEAGRYKIVTRALRIRGDEAKDGDYDVSESQVFSIRYA*
Coding >Hirsu2|4682
ATGGTTGGCCGGTGGTTACGCAGCGGAGCCTCGCTGCTTCTGGCTGCACCATTACACCTGGCTGCCGCCGACCTG
ATTCCTGGAGCCTACCTTTTCCAGCTGGAGCGTCATCATGACACGGCCGCCTTCCTCAGCGCCGTCCAAACGCAC
GGGACGATACAAATGGAGCTGAAGTTCGAGCTGTTCAATGGCGCTTCGGTCCAATTCAACGACCTGCGGAACGTC
GACCGAATCGCCTCCGAGATTGCGGCCCTGCCCGTTGTCAAGAAAATGTGGCCGATGCAAAACTACAGCCAGCCC
GATGAGGGCGTCAAGTGGGTGAGCGCCCCGATCGGCGACACCAAGTCCAGCAACCTCCGAGCACGATCCGTCTAT
GAACACGAGCCCTTTCCGGCACATGCCATGACTCAAGTCGATAGGCTGCACGCCAACGGCGTCACAGGCAGAGGC
ATCAAGATAGCCGTCATCGACAGCGGTGTCGACTACACTCACCCTGCGCTGGGCGGCGGGTGCTTCGGTCCTGGC
TGCTTGGTCGCGCGCGGCTACGATTTCGTCGGGGATGCCTTTGACGGCTCCAACACGCCACACCAGGACGAGGAC
CCGATGGACTGTGGCGGCCACGGCACCCACGTGGCCGGCATCATAGCGGCCCAGCCGGGCAACATGTTTGGTTTT
ACTGGGGCCGCCCCCGGCGTGACGCTGGCGGCATATCGCGTGTTTGGCTGCCGCGGCGGGACCAGGGACGACGTG
CTGATCGCGGCGCTGAACCGCGCGTACGAGGACGGCGCCGACATCATCTCCCTCTCCCTCGGGAGCCCCAGCGGC
TGGTCCGAGCATCCCTGGTCCGCCGCCGTGTCCGATGTCGTCGCCAAGGGGGTTGCCTGCCTCGTGTCGGCCGCC
AACGACGGCGAGATGGGGCTGTTCTACGCCAGCACCGCCGCCGACGGCAAGCGCGTCACTGCCATTGCGGCCTTC
GAGAACATCGTCCACCACGTGCTCCAGTACGACATATCGTACACGGTCGACGGGGGCCCCAGCGTCACCGTGGGC
TTCGTCCAGGGCGAGCCTGCCGACTGGAGCAACGTCTCCCTGCCCCTGTGGGCCGGCAGCTTCGACGTCGAGGCG
CCGGCAGACGGCTGTGCGCCCTTGCCGAGCGACGCGCCCGATCTGAAGGAGCGCATTGTCCTCATCCGCCGAGGG
AGTTGCACGTTCAAGGAAAAGATCAACAACGCGCGCGCCAAGGGCGCCAGGTACATCCTGGTGTACAACAACGCG
CCGCGGGCGATAGAGCTCGACCTCGACATCCCGGCCCTCGCGGGGGTGGGCATGGTTTCCGCAGAGGCGGGCCAT
GCCTGGATCAAGTTGCTGGCGGAGGGGAAAAAGGTCGTGGTCGACATGGTTTCGTATCGGGACGCCAAGCCGCAT
CTCATCAACACTCCGAACCGGGAAGATGGAGGAGCGTTGCTGGAGATGAACTCGTGGGGCCCGACCTGGCAGATG
GATGTCAAGCCTCAGTTCGGAGCCGTGGGCGGCACCGTCCTGTCGACCTATCCCGTCAAGAAGGGGGGCTACGCC
GTCTGGAGCGGCACCTCCCAGGCCTGCCCGCAGGTGGCCGCCATATATGCCCTCATCGCCCAGGTCCGCGGCGGT
CGCGTCGACCCGGGCCTGTTCGAAAGCCTGCTGTCGGCCAACGCGGATCCTCAGCTCTTCCACAACGGAAAGACG
TTTCTGCCCTACCTTGCTCCTGTCGCGCAGCAAGGGGGCGGCATAGTGCGTGCTTACGACGCCGCCTACGCCACG
ACGCTGCTCGAGCCGTCGTCCCTCTCCTTCAACGACACCCAAGGTTTCCTCCGCACCCTCAACTTGACCATCAAG
AACACGGAAAGCCGGGACATCACATACACGGTCTCGCACGTGCCAGCGATTACAATGTACACGCTGCAAAACGGC
TCCATCACGCCGCAGTCGTTTCCTAACGATGTCGTCCATTCCCCGGCCGACCTCGCGTTCAACGGGGAGGAGAGA
CTGGAGGTTGTCGTCGGGGGAGGCGACACTCGCGCCATCAGGGTGGCCCCTACGCCTCCGCAGGGGCTCAATGCG
GATCGCCTGGCGCTCTGGTCCGGCTACATTGCCGTCAACGGGTCCGACGGATCGTCGCTCTCGATCCCTTATCAG
GGCCTCACGGGGTCGCTCCAGAATGCGACGGTCCTGGGGCGGAGAGGCACCTGGATAGCGAAATCGACGGACAAG
GGCCCCTACGACCCCGTGCCGACCAACACGACCTTTACGCTGCCGCGGCCGGGCAGCAGCACGGCCAACGCGACG
CTGCCGTCGCTGCGGGTCGAACTCACGCTGGGCTCGCCGCTGGTGCTGGCAGACGTGGTGGCGGTCGCGGGGGCG
CGTCGCGGCGCGGCCATCGGGCGGATGGCCGACTTCCCGCAGTACTGGCTGCCGCGCCTCTCCTTCTCCGTCAGC
TGGAACGGGACGCTGAGCACGGGGCAGTACGCCGAGGCGGGACGCTACAAGATCGTGACGCGGGCGTTGAGGATC
CGGGGCGACGAGGCCAAGGACGGAGACTACGACGTGAGCGAGTCCCAGGTGTTCTCGATACGATATGCATAG
Transcript >Hirsu2|4682
ATGGTTGGCCGGTGGTTACGCAGCGGAGCCTCGCTGCTTCTGGCTGCACCATTACACCTGGCTGCCGCCGACCTG
ATTCCTGGAGCCTACCTTTTCCAGCTGGAGCGTCATCATGACACGGCCGCCTTCCTCAGCGCCGTCCAAACGCAC
GGGACGATACAAATGGAGCTGAAGTTCGAGCTGTTCAATGGCGCTTCGGTCCAATTCAACGACCTGCGGAACGTC
GACCGAATCGCCTCCGAGATTGCGGCCCTGCCCGTTGTCAAGAAAATGTGGCCGATGCAAAACTACAGCCAGCCC
GATGAGGGCGTCAAGTGGGTGAGCGCCCCGATCGGCGACACCAAGTCCAGCAACCTCCGAGCACGATCCGTCTAT
GAACACGAGCCCTTTCCGGCACATGCCATGACTCAAGTCGATAGGCTGCACGCCAACGGCGTCACAGGCAGAGGC
ATCAAGATAGCCGTCATCGACAGCGGTGTCGACTACACTCACCCTGCGCTGGGCGGCGGGTGCTTCGGTCCTGGC
TGCTTGGTCGCGCGCGGCTACGATTTCGTCGGGGATGCCTTTGACGGCTCCAACACGCCACACCAGGACGAGGAC
CCGATGGACTGTGGCGGCCACGGCACCCACGTGGCCGGCATCATAGCGGCCCAGCCGGGCAACATGTTTGGTTTT
ACTGGGGCCGCCCCCGGCGTGACGCTGGCGGCATATCGCGTGTTTGGCTGCCGCGGCGGGACCAGGGACGACGTG
CTGATCGCGGCGCTGAACCGCGCGTACGAGGACGGCGCCGACATCATCTCCCTCTCCCTCGGGAGCCCCAGCGGC
TGGTCCGAGCATCCCTGGTCCGCCGCCGTGTCCGATGTCGTCGCCAAGGGGGTTGCCTGCCTCGTGTCGGCCGCC
AACGACGGCGAGATGGGGCTGTTCTACGCCAGCACCGCCGCCGACGGCAAGCGCGTCACTGCCATTGCGGCCTTC
GAGAACATCGTCCACCACGTGCTCCAGTACGACATATCGTACACGGTCGACGGGGGCCCCAGCGTCACCGTGGGC
TTCGTCCAGGGCGAGCCTGCCGACTGGAGCAACGTCTCCCTGCCCCTGTGGGCCGGCAGCTTCGACGTCGAGGCG
CCGGCAGACGGCTGTGCGCCCTTGCCGAGCGACGCGCCCGATCTGAAGGAGCGCATTGTCCTCATCCGCCGAGGG
AGTTGCACGTTCAAGGAAAAGATCAACAACGCGCGCGCCAAGGGCGCCAGGTACATCCTGGTGTACAACAACGCG
CCGCGGGCGATAGAGCTCGACCTCGACATCCCGGCCCTCGCGGGGGTGGGCATGGTTTCCGCAGAGGCGGGCCAT
GCCTGGATCAAGTTGCTGGCGGAGGGGAAAAAGGTCGTGGTCGACATGGTTTCGTATCGGGACGCCAAGCCGCAT
CTCATCAACACTCCGAACCGGGAAGATGGAGGAGCGTTGCTGGAGATGAACTCGTGGGGCCCGACCTGGCAGATG
GATGTCAAGCCTCAGTTCGGAGCCGTGGGCGGCACCGTCCTGTCGACCTATCCCGTCAAGAAGGGGGGCTACGCC
GTCTGGAGCGGCACCTCCCAGGCCTGCCCGCAGGTGGCCGCCATATATGCCCTCATCGCCCAGGTCCGCGGCGGT
CGCGTCGACCCGGGCCTGTTCGAAAGCCTGCTGTCGGCCAACGCGGATCCTCAGCTCTTCCACAACGGAAAGACG
TTTCTGCCCTACCTTGCTCCTGTCGCGCAGCAAGGGGGCGGCATAGTGCGTGCTTACGACGCCGCCTACGCCACG
ACGCTGCTCGAGCCGTCGTCCCTCTCCTTCAACGACACCCAAGGTTTCCTCCGCACCCTCAACTTGACCATCAAG
AACACGGAAAGCCGGGACATCACATACACGGTCTCGCACGTGCCAGCGATTACAATGTACACGCTGCAAAACGGC
TCCATCACGCCGCAGTCGTTTCCTAACGATGTCGTCCATTCCCCGGCCGACCTCGCGTTCAACGGGGAGGAGAGA
CTGGAGGTTGTCGTCGGGGGAGGCGACACTCGCGCCATCAGGGTGGCCCCTACGCCTCCGCAGGGGCTCAATGCG
GATCGCCTGGCGCTCTGGTCCGGCTACATTGCCGTCAACGGGTCCGACGGATCGTCGCTCTCGATCCCTTATCAG
GGCCTCACGGGGTCGCTCCAGAATGCGACGGTCCTGGGGCGGAGAGGCACCTGGATAGCGAAATCGACGGACAAG
GGCCCCTACGACCCCGTGCCGACCAACACGACCTTTACGCTGCCGCGGCCGGGCAGCAGCACGGCCAACGCGACG
CTGCCGTCGCTGCGGGTCGAACTCACGCTGGGCTCGCCGCTGGTGCTGGCAGACGTGGTGGCGGTCGCGGGGGCG
CGTCGCGGCGCGGCCATCGGGCGGATGGCCGACTTCCCGCAGTACTGGCTGCCGCGCCTCTCCTTCTCCGTCAGC
TGGAACGGGACGCTGAGCACGGGGCAGTACGCCGAGGCGGGACGCTACAAGATCGTGACGCGGGCGTTGAGGATC
CGGGGCGACGAGGCCAAGGACGGAGACTACGACGTGAGCGAGTCCCAGGTGTTCTCGATACGATATGCATAG
Gene >Hirsu2|4682
ATGGTTGGCCGGTGGTTACGCAGCGGAGCCTCGCTGCTTCTGGCTGCACCATTACACCTGGCTGCCGCCGACCTG
ATTCCTGGAGCCTACCTTTTCCAGCTGGAGCGTCATCATGTGCGTCCCTTCCTCTGGATAGCCTTTCCTACACCT
CATTCATTCGCCAGACAGTCGTGGCAGCATGGACGTACTCATCAAGAATAGGACACGGCCGCCTTCCTCAGCGCC
GTCCAAACGCACGGGACGATACAAATGGAGCTGAAGTTCGAGCTGTTCAATGGCGCTTCGGTCCAATTCAACGAC
CTGCGGAACGTCGACCGAATCGCCTCCGAGATTGCGGCCCTGCCCGTTGTCAAGAAAATGTGGCCGATGCAAAAC
TACAGCCAGCCCGATGAGGGCGTCAAGTGGGTGAGCGCCCCGATCGGCGACACCAAGTCCAGCAACCTCCGAGCA
CGATCCGTCTATGAACACGAGCCCTTTCCGGCACATGCCATGACTCAAGTCGATAGGCTGCACGCCAACGGCGTC
ACAGGCAGAGGCATCAAGATAGCCGTCATCGACAGCGGTGTAAGTTCCACCGTCGCTCCTGGCCGACCCGACGTC
CGCCCGTCCAGCAGAGAGTCATGCGCTGATGGAGTCTGCAGGTCGACTACACTCACCCTGCGCTGGGCGGCGGGT
GCTTCGGTCCTGGCTGCTTGGTCGCGCGCGGCTACGATTTCGTCGGGGATGCCTTTGACGGCTCCAACACGCCAC
ACCAGGACGAGGACCCGATGGACTGTGGCGGCCACGGCACCCACGTGGCCGGCATCATAGCGGCCCAGCCGGGCA
ACATGTTTGGTTTTACTGGGGCCGCCCCCGGCGTGACGCTGGCGGCATATCGCGTGTTTGGCTGCCGCGGCGGGA
CCAGGGACGACGTGCTGATCGCGGCGCTGAACCGCGCGTACGAGGACGGCGCCGACATCATCTCCCTCTCCCTCG
GGAGCCCCAGCGGCTGGTCCGAGCATCCCTGGTCCGCCGCCGTGTCCGATGTCGTCGCCAAGGGGGTTGCCTGCC
TCGTGTCGGCCGCCAACGACGGCGAGATGGGGCTGTTCTACGCCAGCACCGCCGCCGACGGCAAGCGCGTCACTG
CCATTGCGGCCTTCGAGAACATCGTCCACCACGTGCTCCAGTACGACATATCGTACACGGTCGACGGGGGCCCCA
GCGTCACCGTGGGCTTCGTCCAGGGCGAGCCTGCCGACTGGAGCAACGTCTCCCTGCCCCTGTGGGCCGGCAGCT
TCGACGTCGAGGCGCCGGCAGACGGCTGTGCGCCCTTGCCGAGCGACGCGCCCGATCTGAAGGAGCGCATTGTCC
TCATCCGCCGAGGGAGTTGCACGTTCAAGGAAAAGATCAACAACGCGCGCGCCAAGGGCGCCAGGTACATCCTGG
TGTACAACAACGCGCCGCGGGCGATAGAGCTCGACCTCGACATCCCGGCCCTCGCGGGGGTGGGCATGGTTTCCG
CAGAGGCGGGCCATGCCTGGATCAAGTTGCTGGCGGAGGGGAAAAAGGTCGTGGTCGACATGGTTTCGTATCGGG
ACGCCAAGCCGCATCTCATCAACACTCCGAACCGGGAAGATGGAGGAGCGTTGCTGGAGATGAACTCGTGGGGCC
CGACCTGGCAGATGGATGTCAAGCCTCAGTTCGGAGCCGTGGGCGGCACCGTCCTGTCGACCTATCCCGTCAAGA
AGGGGGGCTACGCCGTCTGGAGCGGCACCTCCCAGGCCTGCCCGCAGGTGGCCGCCATATATGCCCTCATCGCCC
AGGTCCGCGGCGGTCGCGTCGACCCGGGCCTGTTCGAAAGCCTGCTGTCGGCCAACGCGGATCCTCAGCTCTTCC
ACAACGGAAAGACGTTTCTGCCCTACCTTGCTCCTGTCGCGCAGCAAGGGGGCGGCATAGTGCGTGCTTACGACG
CCGCCTACGCCACGACGCTGCTCGAGCCGTCGTCCCTCTCCTTCAACGACACCCAAGGTTTCCTCCGCACCCTCA
ACTTGACCATCAAGAACACGGAAAGCCGGGACATCACATACACGGTCTCGCACGTGCCAGCGATTACAATGTACA
CGCTGCAAAACGGCTCCATCACGCCGCAGTCGTTTCCTAACGATGTCGTCCATTCCCCGGCCGACCTCGCGTTCA
ACGGGGAGGAGAGACTGGAGGTTGTCGTCGGGGGAGGCGACACTCGCGCCATCAGGGTGGCCCCTACGCCTCCGC
AGGGGCTCAATGCGGATCGCCTGGCGCTCTGGTCCGGCTACATTGCCGTCAACGGGTCCGACGGATCGTCGCTCT
CGATCCCTTATCAGGGCCTCACGGGGTCGCTCCAGAATGCGACGGTCCTGGGGCGGAGAGGCACCTGGATAGCGA
AATCGACGGACAAGGGCCCCTACGACCCCGTGCCGACCAACACGACCTTTACGCTGCCGCGGCCGGGCAGCAGCA
CGGCCAACGCGACGCTGCCGTCGCTGCGGGTCGAACTCACGCTGGGCTCGCCGCTGGTGCTGGCAGACGTGGTGG
CGGTCGCGGGGGCGCGTCGCGGCGCGGCCATCGGGCGGATGGCCGACTTCCCGCAGTACTGGCTGCCGCGCCTCT
CCTTCTCCGTCAGCTGGAACGGGACGCTGAGCACGGGGCAGTACGCCGAGGCGGGACGCTACAAGATCGTGACGC
GGGCGTTGAGGATCCGGGGCGACGAGGCCAAGGACGGAGACTACGACGTGAGCGAGTCCCAGGTGTTCTCGATAC
GATATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail