Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4661
Gene name
LocationContig_236:8658..10445
Strand-
Gene length (bp)1787
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03637 Mob1_phocein Mob1/phocein family 2.1E-43 104 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74558|MOB2_SCHPO Maintenance of ploidy protein mob2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob2 PE=1 SV=1 104 320 5.0E-36
sp|Q5ABC6|MOB2_CANAL CBK1 kinase activator protein MOB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MOB2 PE=1 SV=1 94 327 3.0E-32
sp|P43563|MOB2_YEAST CBK1 kinase activator protein MOB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOB2 PE=1 SV=2 105 320 1.0E-30
sp|O94360|MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob1 PE=1 SV=1 108 314 1.0E-23
sp|Q54CR8|MOB1B_DICDI MOB kinase activator-like 1 homolog B OS=Dictyostelium discoideum GN=mobB PE=3 SV=1 108 314 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74558|MOB2_SCHPO Maintenance of ploidy protein mob2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob2 PE=1 SV=1 104 320 5.0E-36
sp|Q5ABC6|MOB2_CANAL CBK1 kinase activator protein MOB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MOB2 PE=1 SV=1 94 327 3.0E-32
sp|P43563|MOB2_YEAST CBK1 kinase activator protein MOB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOB2 PE=1 SV=2 105 320 1.0E-30
sp|O94360|MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob1 PE=1 SV=1 108 314 1.0E-23
sp|Q54CR8|MOB1B_DICDI MOB kinase activator-like 1 homolog B OS=Dictyostelium discoideum GN=mobB PE=3 SV=1 108 314 4.0E-23
sp|Q58D63|MOB3A_BOVIN MOB kinase activator 3A OS=Bos taurus GN=MOB3A PE=2 SV=2 117 312 1.0E-22
sp|Q8BPB0|MOB1B_MOUSE MOB kinase activator 1B OS=Mus musculus GN=Mob1b PE=1 SV=3 108 314 1.0E-22
sp|Q7L9L4|MOB1B_HUMAN MOB kinase activator 1B OS=Homo sapiens GN=MOB1B PE=1 SV=3 108 314 1.0E-22
sp|Q9FHI1|MOB1A_ARATH MOB kinase activator-like 1A OS=Arabidopsis thaliana GN=MOB1A PE=2 SV=1 97 314 2.0E-22
sp|Q3T1J9|MOB1A_RAT MOB kinase activator 1A OS=Rattus norvegicus GN=Mob1a PE=2 SV=3 108 314 4.0E-22
sp|Q9H8S9|MOB1A_HUMAN MOB kinase activator 1A OS=Homo sapiens GN=MOB1A PE=1 SV=4 108 314 4.0E-22
sp|Q921Y0|MOB1A_MOUSE MOB kinase activator 1A OS=Mus musculus GN=Mob1a PE=2 SV=3 108 314 4.0E-22
sp|Q5RAE0|MOB1A_PONAB MOB kinase activator 1A OS=Pongo abelii GN=MOB1A PE=2 SV=3 108 314 4.0E-22
sp|Q949G5|MOB1A_MEDSF MOB kinase activator-like 1A OS=Medicago sativa subsp. falcata GN=MOB1-A PE=2 SV=2 97 314 4.0E-22
sp|Q8BSU7|MOB3A_MOUSE MOB kinase activator 3A OS=Mus musculus GN=Mob3a PE=1 SV=1 123 312 7.0E-22
sp|Q2WBN3|MOB1B_MEDSF MOB kinase activator-like 1B OS=Medicago sativa subsp. falcata GN=MOB1-B PE=2 SV=1 97 314 8.0E-22
sp|Q29RK9|MOB3B_BOVIN MOB kinase activator 3B OS=Bos taurus GN=MOB3B PE=2 SV=1 117 312 2.0E-21
sp|Q8VE04|MOB3B_MOUSE MOB kinase activator 3B OS=Mus musculus GN=Mob3b PE=2 SV=1 117 312 2.0E-21
sp|Q86TA1|MOB3B_HUMAN MOB kinase activator 3B OS=Homo sapiens GN=MOB3B PE=1 SV=2 117 312 3.0E-21
sp|Q8GYX0|MOB1B_ARATH MOB kinase activator-like 1B OS=Arabidopsis thaliana GN=MOB1B PE=2 SV=1 97 314 3.0E-21
sp|Q70IA8|MOB3C_HUMAN MOB kinase activator 3C OS=Homo sapiens GN=MOB3C PE=1 SV=1 124 314 6.0E-21
sp|P40484|MOB1_YEAST DBF2 kinase activator protein MOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOB1 PE=1 SV=2 117 313 6.0E-21
sp|Q8BJG4|MOB3C_MOUSE MOB kinase activator 3C OS=Mus musculus GN=Mob3c PE=2 SV=1 123 312 8.0E-21
sp|Q54XJ0|MOB1A_DICDI MOB kinase activator-like 1 homolog A OS=Dictyostelium discoideum GN=mobA PE=3 SV=1 108 319 2.0E-20
sp|Q5EAA4|MOB3C_BOVIN MOB kinase activator 3C OS=Bos taurus GN=MOB3C PE=2 SV=1 124 312 2.0E-20
sp|Q96BX8|MOB3A_HUMAN MOB kinase activator 3A OS=Homo sapiens GN=MOB3A PE=1 SV=1 124 312 3.0E-20
sp|Q54BM4|MOB1C_DICDI MOB kinase activator-like 1 homolog C OS=Dictyostelium discoideum GN=mobC PE=3 SV=1 154 314 4.0E-20
sp|Q5R5Z0|MOB3A_PONAB MOB kinase activator 3A OS=Pongo abelii GN=MOB3A PE=2 SV=1 123 312 4.0E-20
sp|Q95RA8|MOB1_DROME MOB kinase activator-like 1 OS=Drosophila melanogaster GN=mats PE=1 SV=1 108 318 4.0E-20
sp|Q9VL13|MOB3_DROME MOB kinase activator-like 3 OS=Drosophila melanogaster GN=Mob3 PE=2 SV=1 122 312 6.0E-20
sp|F4K495|MOB2A_ARATH MOB kinase activator-like 2A OS=Arabidopsis thaliana GN=MOB2A PE=2 SV=1 117 314 1.0E-19
sp|Q54QV0|MOB2_DICDI MOB kinase activator-like 2 OS=Dictyostelium discoideum GN=mob2 PE=3 SV=1 74 314 4.0E-14
sp|Q70IA6|MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens GN=MOB2 PE=1 SV=1 100 320 6.0E-14
sp|Q9P601|MOB1_NEUCR Probable maintenance of ploidy protein mob1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mob1-1 PE=3 SV=2 78 314 8.0E-14
sp|Q8VI63|MOB2_MOUSE MOB kinase activator 2 OS=Mus musculus GN=Mob2 PE=1 SV=1 100 319 2.0E-13
sp|F4K494|MOB2B_ARATH Putative MOB kinase activator-like 2B OS=Arabidopsis thaliana GN=MOB2B PE=5 SV=1 187 314 5.0E-12
sp|Q2LZ59|MOB2_DROPS MOB kinase activator-like 2 OS=Drosophila pseudoobscura pseudoobscura GN=Mob1 PE=3 SV=2 107 312 4.0E-10
sp|Q8IQG1|MOB2_DROME MOB kinase activator-like 2 OS=Drosophila melanogaster GN=Mob2 PE=1 SV=3 107 312 1.0E-09
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6194 0.4219 0.3077 0.2186 0.1189 0.0124 0.2072 0.3712 0.3875 0.0666

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2847
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7788
Ophiocordyceps australis map64 (Brazil) OphauB2|4349
Ophiocordyceps camponoti-floridani Ophcf2|00313
Ophiocordyceps camponoti-rufipedis Ophun1|553
Ophiocordyceps kimflemingae Ophio5|6092
Ophiocordyceps subramaniannii Hirsu2|4661 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4661
MSNLFSGINARFRGAGSSKPPSQLKTPSPSAAGPAPSPDSQSQASQSSATYAPKVPPLPNSPSLAQTIGMDESSG
VIASGDDIINSYHLPRPLPLWVNGHYTKHIVKGNFMTLSARPKTVEQGEWIAHQIVEHYRNLWNFVRVVHEKEDD
GKTICNATSCPRMSAGANHSFTWLNKQREPVELPAYEYMTLMQRWISGKVDDTNIFPTDPSGVSYAHNPAITNTP
LSQLSNPGEPEYIGKRSGFPENFVEVCQMVFRQMFRVYAHLYWAHFTDPFYHLNLEKQLNSCFSHFVLTATALDM
LKPRELEPMQPLLDIWAANGTFPPESKAYEYANLRAGERLLEMAGVELETR*
Coding >Hirsu2|4661
ATGTCCAATCTGTTCTCGGGAATCAACGCTCGCTTTCGCGGCGCTGGCTCCAGCAAACCACCCAGCCAGCTCAAG
ACGCCTTCTCCCTCCGCCGCCGGCCCAGCACCGTCTCCGGACAGCCAGTCCCAAGCCAGCCAGTCCTCGGCCACC
TACGCCCCCAAGGTCCCGCCCCTGCCAAACTCGCCCTCGCTGGCCCAGACCATCGGCATGGACGAATCCAGCGGC
GTCATCGCCAGCGGCGACGACATCATCAACTCGTACCACCTGCCCAGGCCCCTCCCGCTCTGGGTCAACGGCCAC
TACACGAAGCACATCGTCAAGGGCAACTTCATGACCCTGAGCGCCCGGCCCAAGACGGTAGAGCAGGGCGAGTGG
ATCGCGCACCAGATCGTCGAACACTACCGCAACCTGTGGAACTTTGTCCGCGTCGTGCACGAGAAGGAAGACGAC
GGCAAGACCATCTGCAACGCCACGTCGTGCCCGCGCATGTCCGCCGGGGCGAACCATTCCTTCACCTGGCTCAAC
AAGCAGCGCGAGCCGGTGGAGCTGCCCGCGTACGAGTACATGACGCTGATGCAGCGATGGATCTCGGGCAAGGTC
GACGACACCAACATCTTCCCGACCGACCCGTCGGGCGTCTCGTACGCGCACAACCCCGCCATCACCAACACGCCG
CTCTCGCAGCTGTCGAACCCGGGCGAGCCCGAGTACATCGGGAAGCGGTCCGGCTTCCCCGAGAACTTCGTCGAG
GTCTGCCAGATGGTCTTCCGCCAGATGTTCCGCGTCTACGCCCACCTCTACTGGGCCCACTTCACCGACCCCTTC
TACCACCTGAACCTGGAGAAGCAGCTCAACAGCTGCTTCTCCCACTTCGTCCTCACCGCCACCGCCCTCGACATG
CTGAAGCCGAGGGAGCTCGAGCCGATGCAGCCGCTGCTCGACATCTGGGCCGCCAACGGCACCTTCCCCCCGGAG
TCCAAGGCCTACGAGTACGCCAACCTCCGCGCCGGCGAGCGCCTCCTCGAGATGGCCGGCGTCGAGCTCGAGACG
CGGTAA
Transcript >Hirsu2|4661
ATGTCCAATCTGTTCTCGGGAATCAACGCTCGCTTTCGCGGCGCTGGCTCCAGCAAACCACCCAGCCAGCTCAAG
ACGCCTTCTCCCTCCGCCGCCGGCCCAGCACCGTCTCCGGACAGCCAGTCCCAAGCCAGCCAGTCCTCGGCCACC
TACGCCCCCAAGGTCCCGCCCCTGCCAAACTCGCCCTCGCTGGCCCAGACCATCGGCATGGACGAATCCAGCGGC
GTCATCGCCAGCGGCGACGACATCATCAACTCGTACCACCTGCCCAGGCCCCTCCCGCTCTGGGTCAACGGCCAC
TACACGAAGCACATCGTCAAGGGCAACTTCATGACCCTGAGCGCCCGGCCCAAGACGGTAGAGCAGGGCGAGTGG
ATCGCGCACCAGATCGTCGAACACTACCGCAACCTGTGGAACTTTGTCCGCGTCGTGCACGAGAAGGAAGACGAC
GGCAAGACCATCTGCAACGCCACGTCGTGCCCGCGCATGTCCGCCGGGGCGAACCATTCCTTCACCTGGCTCAAC
AAGCAGCGCGAGCCGGTGGAGCTGCCCGCGTACGAGTACATGACGCTGATGCAGCGATGGATCTCGGGCAAGGTC
GACGACACCAACATCTTCCCGACCGACCCGTCGGGCGTCTCGTACGCGCACAACCCCGCCATCACCAACACGCCG
CTCTCGCAGCTGTCGAACCCGGGCGAGCCCGAGTACATCGGGAAGCGGTCCGGCTTCCCCGAGAACTTCGTCGAG
GTCTGCCAGATGGTCTTCCGCCAGATGTTCCGCGTCTACGCCCACCTCTACTGGGCCCACTTCACCGACCCCTTC
TACCACCTGAACCTGGAGAAGCAGCTCAACAGCTGCTTCTCCCACTTCGTCCTCACCGCCACCGCCCTCGACATG
CTGAAGCCGAGGGAGCTCGAGCCGATGCAGCCGCTGCTCGACATCTGGGCCGCCAACGGCACCTTCCCCCCGGAG
TCCAAGGCCTACGAGTACGCCAACCTCCGCGCCGGCGAGCGCCTCCTCGAGATGGCCGGCGTCGAGCTCGAGACG
CGGTAA
Gene >Hirsu2|4661
ATGTCCAATCTGTTCTCGGGAATGTAAGTCGACGTCCTCCCGTCTATCCTCGCCCGCCCCGTCCGCCTCTTCAAG
CCTCCTCAAGCCCCCGGGCCGGGCCGGGACCAGAGACGGCGCCCGCGGTCCGAGCAGGCGGCGTCGTCGCCTCCC
ACCAAGCGGTGAGGTTGCTTGGTGGACAGCCAGTCAGCCGAGCATCAAGCTGCCGCTCCGGCTGCTCGACTCGAC
CCTCTGGCCTGGAGAAGAGCTCGGCGCGGGTGGGACCGCGCCCGTCGGTCGGAGCTTGAATTCAATGCGGCCTAA
GGGCAAGCCTCCGCAGGCATATCCCGAGTTAGCTTCCGTCAGAGAGCGACGTCTGACGCCCGGAGTCTTCGGCAT
TTCGTTTCGCTGTCTCTGCCGCCTTGCCCCAGATGATCCCCCGATCAGCCGCCGCCCTCCGCCCTCGGCCCTTCG
CCCTCGCCCTCATCCCCTCTGGCCCTCCCCCCTTCTTCTTCCTCCCCCACCCCCTTCTGGCTTCTAGGCTCCCTC
CCGTCCCGATCCTAGTCGCCATCGCACCCCGGAAGTGAATCGCACGGGCCCGTCTCTTGTTGCGCCTCCTTGTCG
CGCCTCCTTGTCGCGCCATGGCTTACTAACCGCCCGACTTCATCTCCAGCAACGCTCGCTTTCGCGGCGCTGGCT
CCAGCAAACCACCCAGCCAGCTCAAGACGCCTTCTCCCTCCGCCGCCGGCCCAGCACCGTCTCCGGACAGCCAGT
CCCAAGCCAGCCAGTCCTCGGCCACCTACGCCCCCAAGGTCCCGCCCCTGCCAAACTCGCCCTCGCTGGCCCAGA
CCATCGGCATGGACGAATCCAGCGGCGTCATCGCCAGCGGCGACGACATCATCAACTCGTACCACCTGCCCAGGC
CCCTCCCGCTCTGGGTCAACGGCCACTACACGAAGCACATCGTCAAGGGCAACTTCATGACCCTGAGCGCCCGGC
CCAAGACGGTAGAGCAGGGCGAGTGGATCGCGCACCAGAGTAGGCACAGCCTCTTCCGTCCGACTCGTCCTCTCC
CTGACACGAATTAGTCGTCGAACACTACCGCAACCTGTGGAACTTTGTCCGCGTCGTGCACGAGAAGGAAGACGA
CGGCAAGACCATCTGCAACGCCACGTCGTGCCCGCGCATGTCCGCCGGGGCGTAAGTCTCGAACCCCCGGCCTCG
CGCCGCCTCCGCTGACCCGCAGCCCGGCCAGGAACCATTCCTTCACCTGGCTCAACAAGCAGCGCGAGCCGGTGG
AGCTGCCCGCGTACGAGTACATGACGCTGATGCAGCGATGGATCTCGGGCAAGGTCGACGACACCAACATCTTCC
CGACCGACCCGTCGGGCGTCTCGTACGCGCACAACCCCGCCATCACCAACACGCCGCTCTCGCAGCTGTCGAACC
CGGGCGAGCCCGAGTACATCGGGAAGCGGTCCGGCTTCCCCGAGAACTTCGTCGAGGTCTGCCAGATGGTCTTCC
GCCAGATGTTCCGCGTCTACGCCCACCTCTACTGGGCCCACTTCACCGACCCCTTCTACCACCTGAACCTGGAGA
AGCAGCTCAACAGCTGCTTCTCCCACTTCGTCCTCACCGCCACCGCCCTCGACATGCTGAAGCCGAGGGAGCTCG
AGCCGATGCAGCCGCTGCTCGACATCTGGGCCGCCAACGGCACCTTCCCCCCGGAGTCCAAGGCCTACGAGTACG
CCAACCTCCGCGCCGGCGAGCGCCTCCTCGAGATGGCCGGCGTCGAGCTCGAGACGCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail