Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4652
Gene name
LocationContig_2352:491..2697
Strand+
Gene length (bp)2206
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07719 TPR_2 Tetratricopeptide repeat 5.5E-05 233 264
PF00515 TPR_1 Tetratricopeptide repeat 9.1E-08 234 264
PF00226 DnaJ DnaJ domain 1.7E-26 554 616
PF13414 TPR_11 TPR repeat 3.1E-06 204 245
PF14559 TPR_19 Tetratricopeptide repeat 5.5E-09 242 292
PF14559 TPR_19 Tetratricopeptide repeat 1.5E-05 439 487
PF13432 TPR_16 Tetratricopeptide repeat 1.4E-07 203 265
PF13432 TPR_16 Tetratricopeptide repeat 6.9E-05 238 288
PF13432 TPR_16 Tetratricopeptide repeat 8.8E-04 366 414
PF13432 TPR_16 Tetratricopeptide repeat 1.5E-02 434 498
PF13181 TPR_8 Tetratricopeptide repeat 3.8E-02 233 264
PF13181 TPR_8 Tetratricopeptide repeat 1.6E-01 266 288
PF13181 TPR_8 Tetratricopeptide repeat 2.0E-01 383 414
PF13181 TPR_8 Tetratricopeptide repeat 2.2E-03 466 498
PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3 2.2E-06 211 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 193 644 1.0E-93
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 196 653 7.0E-73
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 196 648 5.0E-69
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 196 648 7.0E-69
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 196 648 5.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 193 644 1.0E-93
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 196 653 7.0E-73
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 196 648 5.0E-69
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 196 648 7.0E-69
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 196 648 5.0E-68
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 195 624 3.0E-42
sp|Q9LYW9|DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana GN=P58IPK PE=1 SV=1 234 623 8.0E-34
sp|Q27968|DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus GN=DNAJC3 PE=1 SV=1 196 671 8.0E-33
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 196 594 1.0E-31
sp|Q13217|DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens GN=DNAJC3 PE=1 SV=1 196 671 2.0E-31
sp|Q91YW3|DNJC3_MOUSE DnaJ homolog subfamily C member 3 OS=Mus musculus GN=Dnajc3 PE=1 SV=1 196 671 1.0E-30
sp|Q5ZI13|DNJC3_CHICK DnaJ homolog subfamily C member 3 OS=Gallus gallus GN=DNAJC3 PE=2 SV=1 204 666 1.0E-30
sp|Q9R0T3|DNJC3_RAT DnaJ homolog subfamily C member 3 OS=Rattus norvegicus GN=Dnajc3 PE=1 SV=3 196 671 3.0E-30
sp|F4IXE4|TTL2_ARATH TPR repeat-containing thioredoxin TTL2 OS=Arabidopsis thaliana GN=TTL2 PE=2 SV=2 198 550 2.0E-27
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 196 550 6.0E-25
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 195 593 5.0E-24
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 554 616 4.0E-21
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 554 616 6.0E-21
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 553 628 6.0E-21
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 553 628 6.0E-21
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 552 625 9.0E-21
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 554 616 2.0E-20
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 552 625 2.0E-20
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 553 616 3.0E-20
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 552 625 3.0E-20
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 552 625 3.0E-20
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 552 616 3.0E-20
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 552 617 4.0E-20
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 551 634 4.0E-20
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 552 625 4.0E-20
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 554 616 5.0E-20
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 554 616 5.0E-20
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 554 616 5.0E-20
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 554 616 5.0E-20
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 554 616 6.0E-20
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 552 637 6.0E-20
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 552 624 6.0E-20
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 552 625 7.0E-20
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 553 616 9.0E-20
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 552 617 9.0E-20
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 552 617 9.0E-20
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 554 616 9.0E-20
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 553 616 1.0E-19
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 552 625 1.0E-19
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 552 617 1.0E-19
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 552 625 1.0E-19
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 553 616 1.0E-19
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 552 625 1.0E-19
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 551 616 1.0E-19
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 552 625 2.0E-19
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 552 617 2.0E-19
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 552 617 2.0E-19
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 552 617 2.0E-19
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 552 617 2.0E-19
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 552 616 2.0E-19
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 552 616 2.0E-19
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 552 625 2.0E-19
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 553 671 2.0E-19
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 552 616 2.0E-19
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 552 625 2.0E-19
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 552 617 2.0E-19
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 552 617 2.0E-19
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 552 617 2.0E-19
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 552 617 3.0E-19
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 551 616 3.0E-19
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 552 647 3.0E-19
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 551 617 3.0E-19
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 552 637 3.0E-19
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 552 625 3.0E-19
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 551 616 3.0E-19
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 551 660 3.0E-19
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 552 625 3.0E-19
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 552 625 4.0E-19
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 553 616 4.0E-19
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 552 616 4.0E-19
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 552 616 4.0E-19
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 552 642 4.0E-19
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 552 625 4.0E-19
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 554 634 4.0E-19
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 552 616 5.0E-19
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 552 617 5.0E-19
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 552 617 5.0E-19
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 552 638 5.0E-19
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 552 617 5.0E-19
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 552 617 5.0E-19
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 552 625 5.0E-19
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 552 625 6.0E-19
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 552 617 6.0E-19
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 552 625 6.0E-19
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 552 625 6.0E-19
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 552 625 6.0E-19
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 551 617 6.0E-19
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 552 617 6.0E-19
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 552 625 7.0E-19
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 552 625 7.0E-19
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 552 625 7.0E-19
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 552 625 7.0E-19
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 552 617 7.0E-19
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 552 617 7.0E-19
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 552 625 8.0E-19
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 552 625 8.0E-19
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 551 616 8.0E-19
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 552 616 9.0E-19
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 552 617 9.0E-19
sp|Q0VST5|DNAJ_ALCBS Chaperone protein DnaJ OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaJ PE=3 SV=1 552 617 1.0E-18
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 552 617 1.0E-18
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 552 625 1.0E-18
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 552 616 1.0E-18
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 550 616 1.0E-18
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 552 616 1.0E-18
sp|A8FYT9|DNAJ_SHESH Chaperone protein DnaJ OS=Shewanella sediminis (strain HAW-EB3) GN=dnaJ PE=3 SV=1 552 625 1.0E-18
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 552 617 1.0E-18
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 552 625 1.0E-18
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 552 625 1.0E-18
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 552 625 1.0E-18
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 552 617 1.0E-18
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 555 617 1.0E-18
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 555 617 1.0E-18
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 552 616 2.0E-18
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 552 617 2.0E-18
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 552 624 2.0E-18
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 552 617 2.0E-18
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 552 637 2.0E-18
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 552 617 2.0E-18
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 552 649 2.0E-18
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 552 643 2.0E-18
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 552 617 2.0E-18
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 551 654 2.0E-18
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 552 625 2.0E-18
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 552 638 2.0E-18
sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 551 616 2.0E-18
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 554 616 3.0E-18
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 554 616 3.0E-18
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 554 616 3.0E-18
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 552 693 3.0E-18
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 550 625 3.0E-18
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 552 625 3.0E-18
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 551 616 4.0E-18
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 552 625 4.0E-18
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 552 616 4.0E-18
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 550 624 4.0E-18
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 552 625 4.0E-18
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 552 639 4.0E-18
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 554 648 4.0E-18
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 552 616 4.0E-18
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 551 625 5.0E-18
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 551 625 5.0E-18
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 552 624 5.0E-18
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 552 617 5.0E-18
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 552 616 5.0E-18
sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 552 638 5.0E-18
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 554 658 5.0E-18
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 552 616 5.0E-18
sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 552 638 5.0E-18
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 552 625 5.0E-18
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 552 625 5.0E-18
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 551 654 6.0E-18
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 552 634 6.0E-18
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 552 625 6.0E-18
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 551 665 7.0E-18
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 552 617 7.0E-18
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 554 648 8.0E-18
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 552 617 8.0E-18
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 552 616 8.0E-18
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 551 617 8.0E-18
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 552 616 8.0E-18
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 552 617 9.0E-18
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 552 616 9.0E-18
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 552 616 9.0E-18
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 552 616 9.0E-18
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 552 616 9.0E-18
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 552 616 9.0E-18
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 552 616 9.0E-18
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 552 633 9.0E-18
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 552 633 9.0E-18
sp|A9HEA1|DNAJ_GLUDA Chaperone protein DnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1 554 616 9.0E-18
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 552 616 1.0E-17
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 552 625 1.0E-17
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 552 625 1.0E-17
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 552 616 1.0E-17
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 552 617 1.0E-17
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 552 616 1.0E-17
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 551 616 1.0E-17
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 552 617 1.0E-17
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 551 616 1.0E-17
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 552 616 1.0E-17
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 554 616 1.0E-17
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 553 682 1.0E-17
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 554 616 2.0E-17
sp|P26508|NOLC_RHIFR Protein NolC OS=Rhizobium fredii GN=nolC PE=3 SV=1 551 617 2.0E-17
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 552 616 2.0E-17
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 552 625 2.0E-17
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 553 617 2.0E-17
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 553 617 2.0E-17
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 553 617 2.0E-17
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 553 617 2.0E-17
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 552 625 2.0E-17
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 552 616 2.0E-17
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 554 616 2.0E-17
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 552 633 2.0E-17
sp|Q75WD2|DNAJ_ACEP3 Chaperone protein DnaJ OS=Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153) GN=dnaJ PE=3 SV=2 554 617 2.0E-17
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 552 617 2.0E-17
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 553 617 2.0E-17
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 551 632 2.0E-17
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 551 616 2.0E-17
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 552 617 2.0E-17
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 552 616 2.0E-17
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 552 616 2.0E-17
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 552 616 2.0E-17
sp|Q87BS9|DNAJ_XYLFT Chaperone protein DnaJ OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaJ PE=3 SV=1 552 638 2.0E-17
sp|B2I6F5|DNAJ_XYLF2 Chaperone protein DnaJ OS=Xylella fastidiosa (strain M23) GN=dnaJ PE=3 SV=1 552 638 2.0E-17
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 552 617 3.0E-17
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 552 616 3.0E-17
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 553 617 3.0E-17
sp|Q4FNQ0|DNAJ_PELUB Chaperone protein DnaJ OS=Pelagibacter ubique (strain HTCC1062) GN=dnaJ PE=3 SV=1 552 617 3.0E-17
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 552 616 3.0E-17
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 552 617 3.0E-17
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 555 635 3.0E-17
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 552 616 4.0E-17
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 552 617 4.0E-17
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 554 616 4.0E-17
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 551 616 4.0E-17
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 551 616 4.0E-17
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 552 616 4.0E-17
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 552 638 4.0E-17
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 552 638 4.0E-17
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 552 638 5.0E-17
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 553 617 5.0E-17
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 554 616 5.0E-17
sp|A9N8H1|DNAJ_COXBR Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaJ PE=3 SV=1 552 617 5.0E-17
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 552 617 5.0E-17
sp|P42381|DNAJ_COXBU Chaperone protein DnaJ OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaJ PE=3 SV=2 552 617 5.0E-17
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 555 635 5.0E-17
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 552 625 6.0E-17
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 552 625 6.0E-17
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 551 616 6.0E-17
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 551 616 6.0E-17
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 552 625 6.0E-17
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 554 616 7.0E-17
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 552 617 7.0E-17
sp|Q6A662|DNAJ2_PROAC Chaperone protein DnaJ 2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ2 PE=3 SV=1 545 657 7.0E-17
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 554 643 7.0E-17
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 551 620 7.0E-17
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 552 617 7.0E-17
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 552 617 7.0E-17
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 553 656 7.0E-17
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 552 655 7.0E-17
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 551 617 7.0E-17
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 553 682 7.0E-17
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 552 616 8.0E-17
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 554 616 8.0E-17
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 553 694 8.0E-17
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 552 616 8.0E-17
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 553 694 8.0E-17
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 552 617 9.0E-17
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 554 616 9.0E-17
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 552 617 9.0E-17
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 552 616 9.0E-17
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 551 616 9.0E-17
sp|Q64VI7|DNAJ_BACFR Chaperone protein DnaJ OS=Bacteroides fragilis (strain YCH46) GN=dnaJ PE=3 SV=1 552 616 9.0E-17
sp|Q5LED4|DNAJ_BACFN Chaperone protein DnaJ OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaJ PE=3 SV=1 552 616 9.0E-17
sp|Q9RDD7|DNAJ2_STRCO Chaperone protein DnaJ 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ2 PE=3 SV=1 551 620 9.0E-17
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 553 656 9.0E-17
sp|O52164|DNAJ2_STRAL Chaperone protein DnaJ 2 OS=Streptomyces albus G GN=dnaJ2 PE=3 SV=1 551 620 9.0E-17
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 552 625 9.0E-17
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 553 616 1.0E-16
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 553 617 1.0E-16
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 553 617 1.0E-16
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 552 617 1.0E-16
sp|Q0AKB3|DNAJ_MARMM Chaperone protein DnaJ OS=Maricaulis maris (strain MCS10) GN=dnaJ PE=3 SV=1 552 616 1.0E-16
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 554 616 1.0E-16
sp|Q6LUA6|DNAJ_PHOPR Chaperone protein DnaJ OS=Photobacterium profundum GN=dnaJ PE=3 SV=1 552 617 1.0E-16
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 554 616 1.0E-16
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 554 616 1.0E-16
sp|Q49762|DNAJ2_MYCLE Chaperone protein DnaJ 2 OS=Mycobacterium leprae (strain TN) GN=dnaJ2 PE=3 SV=1 551 623 1.0E-16
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 552 625 1.0E-16
sp|Q4KIH0|DNAJ_PSEF5 Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=dnaJ PE=3 SV=1 552 625 1.0E-16
sp|Q6A997|DNAJ1_PROAC Chaperone protein DnaJ 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ1 PE=3 SV=1 551 620 1.0E-16
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 552 617 1.0E-16
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 552 616 1.0E-16
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 552 616 1.0E-16
sp|B0RVU1|DNAJ_XANCB Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 551 616 2.0E-16
sp|Q8PAK8|DNAJ_XANCP Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|Q4UT12|DNAJ_XANC8 Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 553 656 2.0E-16
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 554 675 2.0E-16
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 552 625 2.0E-16
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 553 616 2.0E-16
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 551 616 2.0E-16
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 552 624 2.0E-16
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 551 616 2.0E-16
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 553 617 2.0E-16
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 553 617 2.0E-16
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 554 616 2.0E-16
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 552 625 2.0E-16
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 549 616 2.0E-16
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 549 616 2.0E-16
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 549 616 2.0E-16
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 552 625 2.0E-16
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|B4SSQ7|DNAJ_STRM5 Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|Q316U7|DNAJ_DESAG Chaperone protein DnaJ OS=Desulfovibrio alaskensis (strain G20) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 552 616 2.0E-16
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 552 617 2.0E-16
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 552 617 3.0E-16
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 553 662 3.0E-16
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 552 617 3.0E-16
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 552 616 3.0E-16
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 552 617 3.0E-16
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 552 616 3.0E-16
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 552 616 3.0E-16
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 552 617 3.0E-16
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 552 616 3.0E-16
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 552 616 3.0E-16
sp|P9WNV7|DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ2 PE=1 SV=1 551 620 3.0E-16
sp|P9WNV6|DNAJ2_MYCTO Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ2 PE=3 SV=1 551 620 3.0E-16
sp|P63967|DNAJ2_MYCBO Chaperone protein DnaJ 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ2 PE=3 SV=1 551 620 3.0E-16
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 551 617 3.0E-16
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 552 616 4.0E-16
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 552 616 4.0E-16
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 552 616 4.0E-16
sp|C4Z1J3|DNAJ_EUBE2 Chaperone protein DnaJ OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=dnaJ PE=3 SV=1 552 616 4.0E-16
sp|Q5YNI2|DNAJ2_NOCFA Chaperone protein DnaJ 2 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ2 PE=3 SV=1 548 616 4.0E-16
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 553 658 4.0E-16
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 552 617 4.0E-16
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 553 617 4.0E-16
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 553 617 4.0E-16
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 552 625 5.0E-16
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 553 616 5.0E-16
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 553 617 5.0E-16
sp|Q7Z6W7|DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens GN=DNAJB7 PE=2 SV=2 554 650 5.0E-16
sp|P94319|DNAJ_BRADU Chaperone protein DnaJ OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaJ PE=3 SV=1 547 616 5.0E-16
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 553 682 6.0E-16
sp|Q16D44|DNAJ_ROSDO Chaperone protein DnaJ OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaJ PE=3 SV=1 552 616 6.0E-16
sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 553 617 6.0E-16
sp|Q3J7D9|DNAJ_NITOC Chaperone protein DnaJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaJ PE=3 SV=1 552 617 6.0E-16
sp|Q626I7|DNJ20_CAEBR DnaJ homolog dnj-20 OS=Caenorhabditis briggsae GN=dnj-20 PE=3 SV=1 553 616 6.0E-16
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 425 549 6.0E-16
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 552 625 7.0E-16
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 551 617 7.0E-16
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 551 617 7.0E-16
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 552 617 7.0E-16
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 425 549 7.0E-16
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 554 616 8.0E-16
sp|Q835R5|DNAJ_ENTFA Chaperone protein DnaJ OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaJ PE=3 SV=1 550 616 8.0E-16
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 549 616 8.0E-16
sp|F1RBN2|SPAG1_DANRE Sperm-associated antigen 1A OS=Danio rerio GN=spag1a PE=2 SV=1 155 551 9.0E-16
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 553 617 9.0E-16
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 552 666 9.0E-16
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 552 617 9.0E-16
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 550 675 9.0E-16
sp|Q5FSL4|DNAJ_GLUOX Chaperone protein DnaJ OS=Gluconobacter oxydans (strain 621H) GN=dnaJ PE=3 SV=1 550 616 1.0E-15
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 554 616 1.0E-15
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 553 694 1.0E-15
sp|Q9KD71|DNAJ_BACHD Chaperone protein DnaJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaJ PE=3 SV=1 552 616 1.0E-15
sp|Q128K1|DNAJ_POLSJ Chaperone protein DnaJ OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaJ PE=3 SV=1 552 625 1.0E-15
sp|Q6AN63|DNAJ_DESPS Chaperone protein DnaJ OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaJ PE=3 SV=1 551 617 1.0E-15
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 425 549 1.0E-15
sp|P81999|DJB11_CANLF DnaJ homolog subfamily B member 11 OS=Canis lupus familiaris GN=DNAJB11 PE=1 SV=2 553 617 1.0E-15
sp|A8LQ63|DNAJ_DINSH Chaperone protein DnaJ OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=dnaJ PE=3 SV=1 552 616 1.0E-15
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 550 616 1.0E-15
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 552 617 1.0E-15
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 550 616 2.0E-15
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 551 660 2.0E-15
sp|Q5YZX0|DNAJ1_NOCFA Chaperone protein DnaJ 1 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ1 PE=3 SV=1 551 620 2.0E-15
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 552 617 2.0E-15
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 553 616 2.0E-15
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 551 660 2.0E-15
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 552 616 2.0E-15
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 551 620 2.0E-15
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 551 617 2.0E-15
sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 551 620 2.0E-15
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 551 664 2.0E-15
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 552 616 2.0E-15
sp|P0C0B5|DNAJ_STRPY Chaperone protein DnaJ OS=Streptococcus pyogenes GN=dnaJ PE=3 SV=1 554 616 2.0E-15
sp|P0DA71|DNAJ_STRPQ Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaJ PE=3 SV=1 554 616 2.0E-15
sp|P0DA70|DNAJ_STRP3 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaJ PE=3 SV=1 554 616 2.0E-15
sp|P0C0B6|DNAJ_STRP1 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M1 GN=dnaJ PE=3 SV=1 554 616 2.0E-15
sp|Q8NZM7|DNAJ_STRP8 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaJ PE=3 SV=1 554 616 2.0E-15
sp|Q5XAD7|DNAJ_STRP6 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaJ PE=3 SV=2 554 616 2.0E-15
sp|Q6KHF9|DNAJ_MYCMO Chaperone protein DnaJ OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaJ PE=3 SV=1 551 689 2.0E-15
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 554 616 3.0E-15
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 554 650 3.0E-15
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 552 630 3.0E-15
sp|Q6YPM2|DNAJ_ONYPE Chaperone protein DnaJ OS=Onion yellows phytoplasma (strain OY-M) GN=dnaJ PE=3 SV=1 552 623 3.0E-15
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 551 617 3.0E-15
sp|B3WEQ6|DNAJ_LACCB Chaperone protein DnaJ OS=Lactobacillus casei (strain BL23) GN=dnaJ PE=3 SV=1 552 617 3.0E-15
sp|Q038N5|DNAJ_LACC3 Chaperone protein DnaJ OS=Lactobacillus casei (strain ATCC 334) GN=dnaJ PE=3 SV=1 552 617 3.0E-15
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 551 662 3.0E-15
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 551 617 3.0E-15
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 551 617 3.0E-15
sp|O25890|DNAJ_HELPY Chaperone protein DnaJ OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaJ PE=3 SV=1 551 616 3.0E-15
sp|Q88VM1|DNAJ_LACPL Chaperone protein DnaJ OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaJ PE=3 SV=1 553 616 4.0E-15
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 551 617 4.0E-15
sp|A8EUC7|DNAJ_ARCB4 Chaperone protein DnaJ OS=Arcobacter butzleri (strain RM4018) GN=dnaJ PE=3 SV=1 554 616 4.0E-15
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 555 650 4.0E-15
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 553 616 4.0E-15
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 553 616 4.0E-15
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 553 616 4.0E-15
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 553 616 4.0E-15
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 552 617 4.0E-15
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 552 616 4.0E-15
sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 554 616 4.0E-15
sp|Q9TVP3|JDP_DROME J domain-containing protein OS=Drosophila melanogaster GN=jdp PE=2 SV=2 543 616 5.0E-15
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 552 630 5.0E-15
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 554 616 5.0E-15
sp|P35514|DNAJ_LACLA Chaperone protein DnaJ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaJ PE=3 SV=2 554 616 5.0E-15
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 552 616 5.0E-15
sp|Q5HTK3|DNAJ_CAMJR Chaperone protein DnaJ OS=Campylobacter jejuni (strain RM1221) GN=dnaJ PE=3 SV=1 551 616 5.0E-15
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 552 616 5.0E-15
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 552 617 5.0E-15
sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens GN=SGTB PE=1 SV=1 187 290 2.0E-11
sp|Q8VD33|SGTB_MOUSE Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Mus musculus GN=Sgtb PE=1 SV=1 187 290 3.0E-10
sp|Q80W98|SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus GN=Sgtb PE=1 SV=1 187 290 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6631 0.4817 0.0817 0.2629 0.1468 0.0257 0.2252 0.0969 0.169 0.0247

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2844
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5221
Ophiocordyceps australis map64 (Brazil) OphauB2|6897
Ophiocordyceps camponoti-floridani Ophcf2|07108
Ophiocordyceps camponoti-rufipedis Ophun1|6460
Ophiocordyceps kimflemingae Ophio5|270
Ophiocordyceps subramaniannii Hirsu2|4652 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4652
MKFFGGGKKPATSSSSSSSSSSSKKHASSAGVDDRDLSRHSHSEPSSPSKSPASRSPKKPSRPASYRDAREPKSS
SSPRQSRLSRHSTEPSSSSASSRRHKFDADTHPLNLPPEERKRLSALSNSAMSGSNSMDIDREPVNGASSPSLNG
PLNGPSPSAQANFSVPIANGAGNEEAPTPPPHKSNPSSPVPTPEDDAESYKSAGNRLFKDKNYNKAIEQYSKAVD
LFPDSSTYLGNRAAAYMSNGQYEAALDDCSRAADLDPQNPKILMRLARIYTGLGRPEEAMTTFGRISPPPSAKDT
APAKEMLHHINSAKDTLSRGSAVSMVLHALDQAERGLGPGVSKPRKWQLMRGEAYLTMGRENSLGEAQNIAMSLL
RNNSQDPEALVLRGRILYGQGENDKAIQSFRMAINCDPDFRDAVKWLRIVQKLDRMKEEGNADFKAGRLQSAVDK
YTQALEIDPANRGMNAKLLQNRAQCKIKLKQYDDAIADADRAVSLDPSYTKARKTKANALGQSGKWEDSVREWKS
IQELEPEDRTIPKEIRKAELELKKSMRKDYYKIMGVEKDAGPDDIKKAYRKLAVKLHPDKNPGDEEAEAKFKDMQ
EAYETLSDPQKKAAYDNGDDLMDPSDMFGGGGGGMGGGMGGIDPEILFSMMNQGGFGGGGGGGGFRSAGGFPGGG
GATFSFGNGGGRQRGAGGFPFQ*
Coding >Hirsu2|4652
ATGAAGTTCTTTGGCGGCGGCAAGAAACCTGCCACCTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCCAAGAAG
CACGCCTCCAGCGCCGGTGTCGACGATCGCGACCTCTCCCGACACTCGCATTCCGAGCCGTCGTCGCCTTCGAAA
AGCCCGGCGTCCAGGTCCCCCAAAAAACCGTCGCGCCCTGCCTCGTACCGGGACGCGCGCGAGCCCAAGTCGTCG
TCGTCTCCGCGCCAGTCGAGGCTATCGCGACACTCGACCGAGCCGTCCTCGTCCTCGGCCTCTTCGCGACGGCAC
AAGTTTGACGCCGACACCCACCCCTTGAATCTGCCGCCCGAGGAGCGCAAGCGCCTCTCCGCCCTGTCCAACTCC
GCCATGAGCGGCAGCAACTCCATGGACATCGACCGGGAGCCCGTCAACGGCGCCTCGTCGCCTTCCCTCAACGGG
CCCCTCAACGGGCCCAGCCCCTCGGCCCAGGCCAATTTTTCCGTCCCCATCGCCAACGGCGCCGGCAACGAAGAG
GCGCCCACGCCCCCGCCCCACAAGTCCAACCCGTCCAGCCCCGTCCCGACGCCTGAGGATGACGCCGAATCCTAC
AAGTCGGCCGGCAACCGGCTCTTCAAGGACAAGAACTACAACAAGGCCATCGAGCAGTACTCCAAAGCCGTCGAC
CTGTTTCCCGACTCGTCCACTTACCTCGGCAACCGTGCCGCTGCGTACATGTCCAACGGCCAGTACGAGGCTGCG
CTCGACGACTGCTCGCGCGCCGCCGACCTGGACCCCCAGAACCCAAAGATCCTGATGCGGCTCGCCCGCATCTAC
ACGGGCTTGGGCCGGCCGGAGGAGGCCATGACCACCTTTGGCCGCATCAGCCCGCCACCGTCCGCCAAGGATACC
GCGCCCGCCAAGGAGATGCTGCATCACATCAACTCGGCCAAGGACACCCTGAGCAGAGGCAGCGCCGTGTCCATG
GTGCTTCACGCCCTGGACCAGGCAGAGCGCGGCCTCGGGCCCGGCGTCAGCAAGCCTCGCAAGTGGCAGCTCATG
CGCGGCGAGGCCTACCTGACCATGGGCCGGGAGAACTCGCTCGGCGAGGCGCAGAACATCGCCATGTCGCTGCTC
CGGAATAACAGTCAGGACCCCGAGGCTCTCGTTCTGCGCGGGCGCATTCTCTACGGCCAGGGCGAGAACGACAAG
GCCATCCAGTCCTTTCGCATGGCCATCAACTGCGACCCGGACTTCCGCGATGCCGTCAAGTGGCTGCGCATCGTG
CAGAAGCTCGATCGCATGAAGGAGGAGGGCAACGCCGACTTCAAGGCCGGCCGCCTGCAGTCTGCCGTCGACAAG
TACACCCAGGCGCTCGAGATTGACCCCGCCAACCGCGGCATGAACGCCAAGCTGTTGCAGAACAGGGCACAGTGC
AAGATCAAGCTCAAGCAGTACGACGACGCCATCGCCGACGCCGACCGGGCCGTGAGCCTGGACCCCAGCTACACC
AAGGCGCGAAAGACCAAGGCCAATGCCCTGGGCCAGTCGGGCAAGTGGGAAGACTCGGTGCGGGAATGGAAGTCC
ATCCAAGAGCTCGAGCCGGAAGACCGTACCATCCCCAAGGAGATCCGAAAGGCCGAGCTGGAGCTGAAGAAGAGC
ATGAGGAAGGACTACTACAAGATCATGGGCGTGGAGAAGGATGCCGGCCCAGACGACATCAAGAAGGCCTACCGC
AAGCTGGCCGTCAAGCTCCACCCCGACAAGAACCCCGGCGACGAGGAGGCCGAGGCCAAGTTCAAGGACATGCAG
GAAGCCTACGAGACCTTGAGCGACCCCCAGAAGAAGGCTGCCTACGACAACGGCGACGACCTGATGGACCCGTCC
GACATGTTCGGCGGCGGCGGCGGCGGCATGGGCGGCGGCATGGGCGGCATCGACCCCGAGATCCTCTTCAGCATG
ATGAACCAAGGCGGCTTCGGCGGCGGCGGAGGGGGCGGCGGCTTCCGGAGTGCCGGCGGCTTCCCCGGCGGCGGC
GGCGCGACGTTCAGCTTCGGGAACGGCGGCGGACGCCAAAGAGGCGCCGGCGGCTTCCCTTTCCAATGA
Transcript >Hirsu2|4652
ATGAAGTTCTTTGGCGGCGGCAAGAAACCTGCCACCTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCCAAGAAG
CACGCCTCCAGCGCCGGTGTCGACGATCGCGACCTCTCCCGACACTCGCATTCCGAGCCGTCGTCGCCTTCGAAA
AGCCCGGCGTCCAGGTCCCCCAAAAAACCGTCGCGCCCTGCCTCGTACCGGGACGCGCGCGAGCCCAAGTCGTCG
TCGTCTCCGCGCCAGTCGAGGCTATCGCGACACTCGACCGAGCCGTCCTCGTCCTCGGCCTCTTCGCGACGGCAC
AAGTTTGACGCCGACACCCACCCCTTGAATCTGCCGCCCGAGGAGCGCAAGCGCCTCTCCGCCCTGTCCAACTCC
GCCATGAGCGGCAGCAACTCCATGGACATCGACCGGGAGCCCGTCAACGGCGCCTCGTCGCCTTCCCTCAACGGG
CCCCTCAACGGGCCCAGCCCCTCGGCCCAGGCCAATTTTTCCGTCCCCATCGCCAACGGCGCCGGCAACGAAGAG
GCGCCCACGCCCCCGCCCCACAAGTCCAACCCGTCCAGCCCCGTCCCGACGCCTGAGGATGACGCCGAATCCTAC
AAGTCGGCCGGCAACCGGCTCTTCAAGGACAAGAACTACAACAAGGCCATCGAGCAGTACTCCAAAGCCGTCGAC
CTGTTTCCCGACTCGTCCACTTACCTCGGCAACCGTGCCGCTGCGTACATGTCCAACGGCCAGTACGAGGCTGCG
CTCGACGACTGCTCGCGCGCCGCCGACCTGGACCCCCAGAACCCAAAGATCCTGATGCGGCTCGCCCGCATCTAC
ACGGGCTTGGGCCGGCCGGAGGAGGCCATGACCACCTTTGGCCGCATCAGCCCGCCACCGTCCGCCAAGGATACC
GCGCCCGCCAAGGAGATGCTGCATCACATCAACTCGGCCAAGGACACCCTGAGCAGAGGCAGCGCCGTGTCCATG
GTGCTTCACGCCCTGGACCAGGCAGAGCGCGGCCTCGGGCCCGGCGTCAGCAAGCCTCGCAAGTGGCAGCTCATG
CGCGGCGAGGCCTACCTGACCATGGGCCGGGAGAACTCGCTCGGCGAGGCGCAGAACATCGCCATGTCGCTGCTC
CGGAATAACAGTCAGGACCCCGAGGCTCTCGTTCTGCGCGGGCGCATTCTCTACGGCCAGGGCGAGAACGACAAG
GCCATCCAGTCCTTTCGCATGGCCATCAACTGCGACCCGGACTTCCGCGATGCCGTCAAGTGGCTGCGCATCGTG
CAGAAGCTCGATCGCATGAAGGAGGAGGGCAACGCCGACTTCAAGGCCGGCCGCCTGCAGTCTGCCGTCGACAAG
TACACCCAGGCGCTCGAGATTGACCCCGCCAACCGCGGCATGAACGCCAAGCTGTTGCAGAACAGGGCACAGTGC
AAGATCAAGCTCAAGCAGTACGACGACGCCATCGCCGACGCCGACCGGGCCGTGAGCCTGGACCCCAGCTACACC
AAGGCGCGAAAGACCAAGGCCAATGCCCTGGGCCAGTCGGGCAAGTGGGAAGACTCGGTGCGGGAATGGAAGTCC
ATCCAAGAGCTCGAGCCGGAAGACCGTACCATCCCCAAGGAGATCCGAAAGGCCGAGCTGGAGCTGAAGAAGAGC
ATGAGGAAGGACTACTACAAGATCATGGGCGTGGAGAAGGATGCCGGCCCAGACGACATCAAGAAGGCCTACCGC
AAGCTGGCCGTCAAGCTCCACCCCGACAAGAACCCCGGCGACGAGGAGGCCGAGGCCAAGTTCAAGGACATGCAG
GAAGCCTACGAGACCTTGAGCGACCCCCAGAAGAAGGCTGCCTACGACAACGGCGACGACCTGATGGACCCGTCC
GACATGTTCGGCGGCGGCGGCGGCGGCATGGGCGGCGGCATGGGCGGCATCGACCCCGAGATCCTCTTCAGCATG
ATGAACCAAGGCGGCTTCGGCGGCGGCGGAGGGGGCGGCGGCTTCCGGAGTGCCGGCGGCTTCCCCGGCGGCGGC
GGCGCGACGTTCAGCTTCGGGAACGGCGGCGGACGCCAAAGAGGCGCCGGCGGCTTCCCTTTCCAATGA
Gene >Hirsu2|4652
ATGAAGTTCTTTGGCGGCGGCAAGAAACCTGCCACCTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCCAAGAAG
CACGCCTCCAGCGCCGGTGTCGACGATCGCGACCTCTCCCGACACTCGCATTCCGAGCCGTCGTCGCCTTCGAAA
AGCCCGGCGTCCAGGTCCCCCAAAAAACCGTCGCGCCCTGCCTCGTACCGGGACGCGCGCGAGCCCAAGTCGTCG
TCGTCTCCGCGCCAGTCGAGGCTATCGCGACACTCGACCGAGCCGTCCTCGTCCTCGGCCTCTTCGCGACGGCAC
AAGTTTGACGCCGACACCCACCCCTTGAATCTGCCGCCCGAGGAGCGCAAGCGCCTCTCCGCCCTGTCCAACTCC
GCCATGAGCGGCAGCAACTCCATGGACATCGACCGGGAGCCCGTCAACGGCGCCTCGTCGCCTTCCCTCAACGGG
CCCCTCAACGGGCCCAGCCCCTCGGCCCAGGCCAATTTTTCCGTCCCCATCGCCAACGGCGCCGGCAACGAAGAG
GCGCCCACGCCCCCGCCCCACAAGTCCAACCCGTCCAGCCCCGTCCCGACGCCTGAGGATGACGCCGAATCCTAC
AAGTCGGCCGGCAACCGGCTCTTCAAGGACAAGAACTACAACAAGGCCATCGAGCAGTACTCCAAAGGTAGGCCG
GCCGGCTTCTCGCTCGCCGACTCGGCGCTGACCCCTTGATGATGCAGCCGTCGACCTGTTTCCCGACTCGTCCAC
TTACCTCGGCAACCGTGCCGCTGCGTACATGTCCAACGGCCAGTACGAGGCTGCGCTCGACGACTGCTCGCGCGC
CGCCGACCTGGACCCCCAGAACCCAAAGATCCTGATGCGGCTCGCCCGCATCTACACGGGCTTGGGCCGGCCGGA
GGAGGCCATGACCACCTTTGGCCGCATCAGCCCGCCACCGTCCGCCAAGGATACCGCGCCCGCCAAGGAGATGCT
GCATCACATCAACTCGGCCAAGGACACCCTGAGCAGAGGCAGCGCCGTGTCCATGGTGCTTCACGCCCTGGACCA
GGCAGAGCGCGGCCTCGGGCCCGGCGTCAGCAAGCCTCGCAAGTGGCAGCTCATGCGCGGCGAGGCCTACCTGAC
CATGGGCCGGGAGAACTCGCTCGGCGAGGCGCAGAACATCGCCATGTCGCTGCTCCGGAATAACAGTCAGGACCC
CGAGGCTCTCGTTCTGCGCGGGCGCATTCTCTACGGCCAGGGCGAGAACGACAAGGCCATCCAGTCCTTTCGCAT
GGCCATCAACTGCGACCCGGACTTCCGCGATGCCGTCAAGTGGCTGCGCATCGTGCAGAAGCTCGATCGCATGAA
GGAGGAGGGCAACGCCGACTTCAAGGCCGGCCGCCTGCAGTCTGCCGTCGACAAGTACACCCAGGCGCTCGAGAT
TGACCCCGCCAACCGCGGCATGAACGCCAAGCTGTTGCAGAACAGGGCACAGTGCAAGATCAAGCTCAAGCAGTA
CGACGACGCCATCGCCGACGCCGACCGGGCCGTGAGCCTGGACCCCAGCTACACCAAGGCGCGAAAGACCAAGGC
CAATGCCCTGGGCCAGTCGGGCAAGTGGGAAGACTCGGTGCGGGAATGGAAGTCCATCCAAGAGCTCGAGCCGGA
AGACCGTACCATCCCCAAGGAGATCCGAAAGGCCGAGCTGGAGCTGAAGAAGAGCATGAGGAAGGACTACTACAA
GATCATGGGCGTGGAGAAGGATGCCGGCCCAGACGACATCAAGAAGGCCTACCGCAAGCTGGCCGTCAAGCTCCA
CCCCGACAAGAACCCCGGCGACGAGGAGGCCGAGGCCAAGTTCAAGGACATGCAGGAAGCCTACGAGACCTTGAG
CGACCCCCAGTGAGTGCCGGACACCGGCCGCCCCCCGCGCTGTACGCGAAACTGACTCCCCAGCAGGAAGAAGGC
TGCCTACGACAACGGCGACGACCTGATGGACCCGTCCGACATGTTCGGCGGCGGCGGCGGCGGCATGGGCGGCGG
CATGGGCGGCATCGACCCCGAGATCCTCTTCAGCATGATGAACCAAGGCGGCTTCGGCGGCGGCGGAGGGGGCGG
CGGCTTCCGGAGTGCCGGCGGCTTCCCCGGCGGCGGCGGCGCGACGTTCAGCTTCGGGAACGGCGGCGGACGCCA
AAGAGGCGCCGGCGGCTTCCCTTTCCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail