Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4651
Gene name
LocationContig_2351:1389..2015
Strand-
Gene length (bp)626
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08491 SE Squalene epoxidase 1.0E-29 24 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92206|ERG1_CANAL Squalene monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG1 PE=3 SV=1 23 159 8.0E-29
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG1 PE=3 SV=2 39 156 1.0E-23
sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg1 PE=3 SV=1 28 156 5.0E-23
sp|P32476|ERG1_YEAST Squalene monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG1 PE=1 SV=2 39 156 1.0E-21
sp|P52020|ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus GN=Sqle PE=2 SV=1 7 156 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92206|ERG1_CANAL Squalene monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG1 PE=3 SV=1 23 159 8.0E-29
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG1 PE=3 SV=2 39 156 1.0E-23
sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg1 PE=3 SV=1 28 156 5.0E-23
sp|P32476|ERG1_YEAST Squalene monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG1 PE=1 SV=2 39 156 1.0E-21
sp|P52020|ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus GN=Sqle PE=2 SV=1 7 156 3.0E-18
sp|P52019|ERG1_MOUSE Squalene monooxygenase OS=Mus musculus GN=Sqle PE=2 SV=1 7 156 4.0E-18
sp|Q14534|ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens GN=SQLE PE=1 SV=3 7 156 9.0E-18
sp|Q75F69|ERG1_ASHGO Squalene monooxygenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG1 PE=3 SV=1 38 159 3.0E-16
sp|O48651|ERG1_PANGI Squalene monooxygenase OS=Panax ginseng PE=2 SV=1 23 129 8.0E-14
sp|Q9SM02|ERG14_ARATH Squalene epoxidase 1 OS=Arabidopsis thaliana GN=SQE1 PE=1 SV=1 23 129 2.0E-13
sp|Q8VYH2|ERG16_ARATH Squalene epoxidase 3 OS=Arabidopsis thaliana GN=SQE3 PE=1 SV=1 10 129 4.0E-13
sp|O81000|ERG15_ARATH Squalene epoxidase 2, mitochondrial OS=Arabidopsis thaliana GN=SQE2 PE=1 SV=1 28 118 2.0E-12
sp|O65726|ERG12_BRANA Squalene monooxygenase 1,2 OS=Brassica napus GN=SQP1,2 PE=2 SV=1 17 156 7.0E-10
sp|O65404|ERG11_ARATH Squalene epoxidase 5 OS=Arabidopsis thaliana GN=SQE5 PE=2 SV=2 17 156 5.0E-09
sp|O65727|ERG11_BRANA Squalene monooxygenase 1,1 OS=Brassica napus GN=SQP1,1 PE=2 SV=1 23 113 7.0E-09
sp|O65402|ERG12_ARATH Squalene epoxidase 6 OS=Arabidopsis thaliana GN=SQE6 PE=2 SV=1 17 156 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016021 integral component of membrane Yes
GO:0055114 oxidation-reduction process Yes
GO:0004506 squalene monooxygenase activity Yes
GO:1901363 heterocyclic compound binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0004497 monooxygenase activity No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0044425 membrane part No
GO:0050662 coenzyme binding No
GO:0016491 oxidoreductase activity No
GO:0031224 intrinsic component of membrane No
GO:0048037 cofactor binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 100 122 22
2 132 154 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4651
MSLEDQGQAVVAGRDNPLARLALDEAEDAAAVAAAVDAFYWRRKRCSAIINVLAQALYTLFAAEDRPLRALQRGC
FDYFRRGVTDGPCALLGGLLHRPAILAYHFFSVAFLAVWLNARAVVGSGALAPLRLPLALIDAVLILARASVVFL
PVLWRECFR*
Coding >Hirsu2|4651
ATGAGCCTCGAAGACCAGGGCCAGGCCGTCGTCGCCGGCCGTGACAATCCTCTCGCCCGTCTGGCCCTGGACGAA
GCCGAGGACGCCGCCGCCGTCGCCGCCGCCGTCGACGCCTTCTACTGGCGCCGCAAGCGCTGCTCCGCCATCATC
AACGTCCTCGCCCAGGCCCTCTACACCCTCTTCGCGGCCGAGGACCGCCCGCTGCGCGCCCTGCAGCGCGGCTGC
TTCGACTACTTCCGCCGCGGCGTCACCGACGGGCCCTGCGCCCTGCTCGGCGGCCTGCTGCACCGGCCCGCCATC
CTCGCCTACCACTTCTTCTCCGTCGCCTTCCTGGCCGTCTGGCTCAACGCCCGCGCCGTCGTCGGCTCCGGCGCC
CTCGCGCCCCTGCGCCTGCCCCTCGCCCTCATCGACGCCGTCCTGATCCTCGCCCGCGCCAGCGTCGTCTTCTTG
CCCGTCCTGTGGCGCGAGTGCTTCCGCTGA
Transcript >Hirsu2|4651
ATGAGCCTCGAAGACCAGGGCCAGGCCGTCGTCGCCGGCCGTGACAATCCTCTCGCCCGTCTGGCCCTGGACGAA
GCCGAGGACGCCGCCGCCGTCGCCGCCGCCGTCGACGCCTTCTACTGGCGCCGCAAGCGCTGCTCCGCCATCATC
AACGTCCTCGCCCAGGCCCTCTACACCCTCTTCGCGGCCGAGGACCGCCCGCTGCGCGCCCTGCAGCGCGGCTGC
TTCGACTACTTCCGCCGCGGCGTCACCGACGGGCCCTGCGCCCTGCTCGGCGGCCTGCTGCACCGGCCCGCCATC
CTCGCCTACCACTTCTTCTCCGTCGCCTTCCTGGCCGTCTGGCTCAACGCCCGCGCCGTCGTCGGCTCCGGCGCC
CTCGCGCCCCTGCGCCTGCCCCTCGCCCTCATCGACGCCGTCCTGATCCTCGCCCGCGCCAGCGTCGTCTTCTTG
CCCGTCCTGTGGCGCGAGTGCTTCCGCTGA
Gene >Hirsu2|4651
ATGAGTGCACTTTCACTTCCATGCCTGTTGTTCCGAGCCCGATCCGACGATTGTGACGCGTAGCCTGCGTGCTCT
CCCTGGCGGGCGGAGCGTCTTGCGGCGTCGTCGTCTGCGGACCACCGCCCTCTTTTCCACTCCCGGCAAAGTCAG
GCCTCGAAGACCAGGGCCAGGCCGTCGTCGCCGGCCGTGACAATCCTCTCGCCCGTCTGGCCCTGGACGAAGCCG
AGGACGCCGCCGCCGTCGCCGCCGCCGTCGACGCCTTCTACTGGCGCCGCAAGCGCTGCTCCGCCATCATCAACG
TCCTCGCCCAGGCCCTCTACACCCTCTTCGCGGCCGAGGACCGCCCGCTGCGCGCCCTGCAGCGCGGCTGCTTCG
ACTACTTCCGCCGCGGCGTCACCGACGGGCCCTGCGCCCTGCTCGGCGGCCTGCTGCACCGGCCCGCCATCCTCG
CCTACCACTTCTTCTCCGTCGCCTTCCTGGCCGTCTGGCTCAACGCCCGCGCCGTCGTCGGCTCCGGCGCCCTCG
CGCCCCTGCGCCTGCCCCTCGCCCTCATCGACGCCGTCCTGATCCTCGCCCGCGCCAGCGTCGTCTTCTTGCCCG
TCCTGTGGCGCGAGTGCTTCCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail