Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4644
Gene name
LocationContig_235:15013..16864
Strand-
Gene length (bp)1851
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.7E-12 104 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 41 615 3.0E-133
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 78 616 6.0E-124
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 46 611 2.0E-107
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 66 608 2.0E-102
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 66 608 5.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 41 615 3.0E-133
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 78 616 6.0E-124
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 46 611 2.0E-107
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 66 608 2.0E-102
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 66 608 5.0E-102
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 29 611 2.0E-86
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 65 610 2.0E-63
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 49 616 7.0E-58
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 88 598 1.0E-53
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 77 609 1.0E-48
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 15 599 4.0E-44
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 16 616 1.0E-39
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 84 526 6.0E-09
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 84 354 2.0E-08
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 130 378 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 169 191 22
3 204 223 19
4 238 260 22
5 295 317 22
6 327 344 17
7 374 393 19
8 403 425 22
9 430 452 22
10 462 484 22
11 497 519 22
12 570 592 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4644
MCRPSTDAEAAPLLGPAEPAAHGQPSAASSEGGRPSSLSSSTSPSSTSSRPPSVAPDGFRGRAPGIARMDVASAR
LTTAQRAWLLAGIFLVGYAYGLESQVRSAYQPYATSSFSLHSYLSTINVLRSVIAVAVQPTAAKVADVLGRFEVV
AASTVCYVVGMAIESTAGSVYAFCAGAVVYQIGYTSIVLLLEVLVADFSSMRARVFFSYIPALPFIVNTWISGSL
TSAVLAVTTWRWGIGMWCIIYPVASLPLLSALYVLDRRRALVPDKPLRAAAHLAGPSKSGAAALFHQLDLVGLVG
LIAAFALVLAPLTVVGSTVAHWHNPRILAPLVVGLAFVPLFTLWEKWGARTPLVPFGLLSDRGVWSALAVRSLLN
FAWAVQGNYLYTVLIVAFDFSIESATRILSFFSFFGVVSGVVVGVVVYRLRRLKFIIVSGAFLFMAGLAVLCHFP
GGASYQSKAGIIGGQVLIGLASGLFAYPTQASIQASATRDHVAILTGLYLSFYNIGSAFGTCLAGAIWTKTLLPV
LTANLAFQPNATLARAMYDSPFPVVERYPVGTEIRDAIIRSYQHVQRLLCLAGLLLCVPMIAFALALRNPKLSKR
QVQREAIEAAEGGETR*
Coding >Hirsu2|4644
ATGTGTCGCCCGAGCACCGATGCCGAGGCGGCGCCGCTTCTGGGTCCCGCCGAGCCCGCCGCCCATGGCCAGCCG
TCGGCCGCGTCGTCGGAAGGCGGCCGGCCGTCGTCGTTGTCGTCGTCGACGTCGCCCTCGTCGACGTCGTCGCGC
CCGCCGTCGGTCGCCCCGGACGGTTTCCGCGGCAGGGCGCCCGGCATCGCCCGCATGGACGTCGCCTCGGCCCGG
CTGACGACGGCCCAGCGCGCCTGGCTCTTGGCCGGCATCTTCCTCGTCGGCTACGCCTACGGGCTCGAGAGCCAG
GTCCGGTCGGCCTACCAGCCTTACGCCACGTCGAGCTTCTCGCTGCACTCGTACCTGTCCACCATCAACGTCCTG
CGCAGCGTCATCGCCGTCGCCGTCCAGCCCACGGCCGCCAAGGTGGCCGACGTGCTGGGCCGCTTCGAGGTCGTC
GCCGCCTCCACCGTCTGCTACGTCGTCGGCATGGCCATCGAGTCGACGGCCGGGTCCGTCTACGCCTTCTGCGCC
GGCGCCGTCGTCTACCAGATCGGCTATACCTCCATCGTCCTCCTGCTCGAGGTCCTCGTCGCCGACTTCTCGTCG
ATGCGCGCCCGCGTCTTCTTCAGCTACATCCCCGCCCTGCCCTTCATCGTCAACACCTGGATCAGCGGCAGCCTG
ACCTCGGCCGTCCTGGCCGTCACCACCTGGCGCTGGGGCATCGGCATGTGGTGCATCATCTACCCCGTCGCCTCC
CTGCCCCTGCTCTCCGCCCTCTATGTCCTCGACCGGCGCCGCGCCCTCGTGCCCGACAAGCCTCTGCGCGCCGCC
GCCCACCTCGCCGGCCCGTCCAAGTCGGGCGCCGCCGCTCTCTTCCACCAGCTCGACCTGGTCGGCCTGGTCGGC
CTCATCGCCGCCTTCGCCCTCGTCCTCGCGCCGCTGACCGTCGTCGGGAGCACCGTCGCCCACTGGCACAACCCT
CGCATCCTCGCGCCCCTCGTCGTCGGCCTCGCCTTCGTCCCGCTCTTCACCCTGTGGGAGAAGTGGGGGGCCAGG
ACGCCGCTCGTGCCCTTTGGCCTGCTGAGCGATCGCGGCGTCTGGTCCGCTCTGGCCGTGAGGAGCCTGCTCAAC
TTTGCCTGGGCCGTCCAGGGCAACTACCTCTACACCGTCCTCATCGTCGCCTTCGACTTCTCCATCGAGTCGGCC
ACGCGCATCCTGTCCTTCTTCTCCTTCTTCGGCGTCGTCAGCGGCGTCGTCGTTGGCGTTGTCGTCTACCGCCTC
CGGCGCCTCAAGTTCATCATCGTCAGCGGGGCCTTCCTCTTCATGGCCGGCCTCGCCGTCCTCTGCCACTTTCCC
GGCGGCGCCTCGTACCAGTCCAAGGCCGGCATCATCGGCGGCCAGGTCCTCATCGGCCTGGCCAGCGGCCTGTTC
GCCTACCCGACCCAGGCCTCCATCCAGGCGTCGGCGACGCGCGACCACGTCGCCATCCTGACGGGGCTGTACCTG
TCCTTCTACAACATCGGCAGTGCCTTCGGCACCTGCCTGGCCGGCGCCATCTGGACGAAGACGCTGCTCCCAGTC
CTGACGGCCAACCTCGCCTTCCAGCCCAACGCCACGCTGGCCAGGGCCATGTACGACTCGCCCTTTCCGGTCGTC
GAGCGCTATCCGGTGGGGACGGAGATCCGCGACGCCATCATCAGGAGCTACCAGCACGTCCAGCGCTTGCTCTGC
CTGGCCGGCCTCTTGCTCTGCGTGCCCATGATCGCATTTGCGCTGGCCCTGAGGAACCCCAAGCTCTCGAAGCGG
CAGGTCCAGCGGGAGGCGATTGAGGCGGCCGAGGGGGGGGAGACGAGATGA
Transcript >Hirsu2|4644
ATGTGTCGCCCGAGCACCGATGCCGAGGCGGCGCCGCTTCTGGGTCCCGCCGAGCCCGCCGCCCATGGCCAGCCG
TCGGCCGCGTCGTCGGAAGGCGGCCGGCCGTCGTCGTTGTCGTCGTCGACGTCGCCCTCGTCGACGTCGTCGCGC
CCGCCGTCGGTCGCCCCGGACGGTTTCCGCGGCAGGGCGCCCGGCATCGCCCGCATGGACGTCGCCTCGGCCCGG
CTGACGACGGCCCAGCGCGCCTGGCTCTTGGCCGGCATCTTCCTCGTCGGCTACGCCTACGGGCTCGAGAGCCAG
GTCCGGTCGGCCTACCAGCCTTACGCCACGTCGAGCTTCTCGCTGCACTCGTACCTGTCCACCATCAACGTCCTG
CGCAGCGTCATCGCCGTCGCCGTCCAGCCCACGGCCGCCAAGGTGGCCGACGTGCTGGGCCGCTTCGAGGTCGTC
GCCGCCTCCACCGTCTGCTACGTCGTCGGCATGGCCATCGAGTCGACGGCCGGGTCCGTCTACGCCTTCTGCGCC
GGCGCCGTCGTCTACCAGATCGGCTATACCTCCATCGTCCTCCTGCTCGAGGTCCTCGTCGCCGACTTCTCGTCG
ATGCGCGCCCGCGTCTTCTTCAGCTACATCCCCGCCCTGCCCTTCATCGTCAACACCTGGATCAGCGGCAGCCTG
ACCTCGGCCGTCCTGGCCGTCACCACCTGGCGCTGGGGCATCGGCATGTGGTGCATCATCTACCCCGTCGCCTCC
CTGCCCCTGCTCTCCGCCCTCTATGTCCTCGACCGGCGCCGCGCCCTCGTGCCCGACAAGCCTCTGCGCGCCGCC
GCCCACCTCGCCGGCCCGTCCAAGTCGGGCGCCGCCGCTCTCTTCCACCAGCTCGACCTGGTCGGCCTGGTCGGC
CTCATCGCCGCCTTCGCCCTCGTCCTCGCGCCGCTGACCGTCGTCGGGAGCACCGTCGCCCACTGGCACAACCCT
CGCATCCTCGCGCCCCTCGTCGTCGGCCTCGCCTTCGTCCCGCTCTTCACCCTGTGGGAGAAGTGGGGGGCCAGG
ACGCCGCTCGTGCCCTTTGGCCTGCTGAGCGATCGCGGCGTCTGGTCCGCTCTGGCCGTGAGGAGCCTGCTCAAC
TTTGCCTGGGCCGTCCAGGGCAACTACCTCTACACCGTCCTCATCGTCGCCTTCGACTTCTCCATCGAGTCGGCC
ACGCGCATCCTGTCCTTCTTCTCCTTCTTCGGCGTCGTCAGCGGCGTCGTCGTTGGCGTTGTCGTCTACCGCCTC
CGGCGCCTCAAGTTCATCATCGTCAGCGGGGCCTTCCTCTTCATGGCCGGCCTCGCCGTCCTCTGCCACTTTCCC
GGCGGCGCCTCGTACCAGTCCAAGGCCGGCATCATCGGCGGCCAGGTCCTCATCGGCCTGGCCAGCGGCCTGTTC
GCCTACCCGACCCAGGCCTCCATCCAGGCGTCGGCGACGCGCGACCACGTCGCCATCCTGACGGGGCTGTACCTG
TCCTTCTACAACATCGGCAGTGCCTTCGGCACCTGCCTGGCCGGCGCCATCTGGACGAAGACGCTGCTCCCAGTC
CTGACGGCCAACCTCGCCTTCCAGCCCAACGCCACGCTGGCCAGGGCCATGTACGACTCGCCCTTTCCGGTCGTC
GAGCGCTATCCGGTGGGGACGGAGATCCGCGACGCCATCATCAGGAGCTACCAGCACGTCCAGCGCTTGCTCTGC
CTGGCCGGCCTCTTGCTCTGCGTGCCCATGATCGCATTTGCGCTGGCCCTGAGGAACCCCAAGCTCTCGAAGCGG
CAGGTCCAGCGGGAGGCGATTGAGGCGGCCGAGGGGGGGGAGACGAGATGA
Gene >Hirsu2|4644
ATGTGTCGCCCGAGCACCGATGCCGAGGCGGCGCCGCTTCTGGGTCCCGCCGAGCCCGCCGCCCATGGCCAGCCG
TCGGCCGCGTCGTCGGAAGGCGGCCGGCCGTCGTCGTTGTCGTCGTCGACGTCGCCCTCGTCGACGTCGTCGCGC
CCGCCGTCGGTCGCCCCGGACGGTTTCCGCGGCAGGGCGCCCGGCATCGCCCGCATGGACGTCGCCTCGGCCCGG
CTGACGACGGCCCAGCGCGCCTGGCTCTTGGCCGGCATCTTCCTCGTCGGCTACGCCTACGGGCTCGAGAGCCAG
GTCCGGTCGGCCTACCAGCCTTACGCCACGTCGAGCTTCTCGCTGCACTCGTACCTGTCCACCATCAACGTCCTG
CGCAGCGTCATCGCCGTCGCCGTCCAGCCCACGGCCGCCAAGGTGGCCGACGTGCTGGGCCGCTTCGAGGTCGTC
GCCGCCTCCACCGTCTGCTACGTCGTCGGCATGGCCATCGAGTCGACGGCCGGGTCCGTCTACGCCTTCTGCGCC
GGCGCCGTCGTCTACCAGATCGGCTATACCTCCATCGTCCTCCTGCTCGAGGTCCTCGTCGCCGACTTCTCGTCG
ATGCGCGCCCGCGTCTTCTTCAGCTACATCCCCGCCCTGCCCTTCATCGTCAACACCTGGATCAGCGGCAGCCTG
ACCTCGGCCGTCCTGGCCGTCACCACCTGGCGCTGGGGCATCGGCATGTGGTGCATCATCTACCCCGTCGCCTCC
CTGCCCCTGCTCTCCGCCCTCTATGTCCTCGACCGGCGCCGCGCCCTCGTGCCCGACAAGCCTCTGCGCGCCGCC
GCCCACCTCGCCGGCCCGTCCAAGTCGGGCGCCGCCGCTCTCTTCCACCAGCTCGACCTGGTCGGCCTGGTCGGC
CTCATCGCCGCCTTCGCCCTCGTCCTCGCGCCGCTGACCGTCGTCGGGAGCACCGTCGCCCACTGGCACAACCCT
CGCATCCTCGCGCCCCTCGTCGTCGGCCTCGCCTTCGTCCCGCTCTTCACCCTGTGGGAGAAGTGGGGGGCCAGG
ACGCCGCTCGTGCCCTTTGGCCTGCTGAGCGATCGCGGCGTCTGGTCCGCTCTGGCCGTGAGGAGCCTGCTCAAC
TTTGCCTGGGCCGTCCAGGGCAACTACCTCTACACCGTCCTCATCGTCGCCTTCGACTTCTCCATCGAGTCGGCC
ACGCGCATCCTGTCCTTCTTCTCCTTCTTCGGCGTCGTCAGCGGCGTCGTCGTTGGCGTTGTCGTCTACCGCCTC
CGGCGCCTCAAGTTCATCATCGTCAGCGGGGCCTTCCTCTTCATGGCCGGCCTCGCCGTCCTCTGCCACTTTCCC
GGCGGCGCCTCGTACCAGTCCAAGGCCGGCATCATCGGCGGCCAGGTCCTCATCGGCCTGGCCAGCGGCCTGTTC
GCCTACCCGACCCAGGCCTCCATCCAGGCGTCGGCGACGCGCGACCACGTCGCCATCCTGACGGGGCTGTACCTG
TCCTTCTACAACATCGGCAGTGCCTTCGGCACCTGCCTGGCCGGCGCCATCTGGACGAAGACGCTGCTCCCAGTC
CTGACGGCCAACCTCGCCTTCCAGCCCAACGCCACGCTGGCCAGGGCCATGTACGACTCGCCCTTTCCGGTCGTC
GAGCGCTATCCGGTGGGGACGGAGATCCGCGACGCCATCATCAGGAGCTACCAGCACGTCCAGCGCTTGCTCTGC
CTGGCCGGCCTCTTGCTCTGCGTGCCCATGATCGCATTTGCGCTGGCCCTGAGGAACCCCAAGCTCTCGAAGCGG
CAGGTCCAGCGGGAGGCGATTGAGGCGGCCGAGGGGGGGGAGACGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail