Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4638
Gene name
LocationContig_235:2890..4055
Strand-
Gene length (bp)1165
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10176 DUF2370 Protein of unknown function (DUF2370) 3.4E-89 109 316

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38356|BSD2_YEAST Metal homeostatis protein BSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSD2 PE=1 SV=1 114 308 1.0E-34
sp|Q9P3T9|BSD2_SCHPO Probable metal homeostasis protein bsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsd1 PE=3 SV=1 117 235 2.0E-30

GO

GO Term Description Terminal node
GO:0030001 metal ion transport Yes
GO:0007034 vacuolar transport Yes
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0006812 cation transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.124 0.1808 0.0401 0.124 0.1017 0.0033 0.364 0.8472 0.5187 0.0108

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2840
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2059
Ophiocordyceps australis map64 (Brazil) OphauB2|3188
Ophiocordyceps camponoti-floridani Ophcf2|02610
Ophiocordyceps camponoti-rufipedis Ophun1|3165
Ophiocordyceps kimflemingae Ophio5|3469
Ophiocordyceps subramaniannii Hirsu2|4638 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4638
MPGRYERINDRDDEDHVDGTVSESTTPPLAIPSSPPPSFHSRASSPSRRGVDPALADAFDADDASDDDDDADDRQ
RLVRQNTTPSTSCATPPTGAPAQSTDAPAVSSGSRPRYVGGGVGTDGVFANLSARPERVDSEKEEQPPTYEQAAA
DAAPPYWETTILAPGFGGPDEVYVDGLPVGSVFSFIWNGMISTSFQLVGFLLTYLLHSTHAAKNGSRAGLGITLI
QYGFYMKGTSEGEPPSMSGPDGYAAPPDPNSHEFDPGEVADGGSGGGSAITGGEWMSYVLMVVGWFILIKSVAEY
LRARRHEQLVMQSPDRGLGVPIIAEGETVEHVV*
Coding >Hirsu2|4638
ATGCCTGGCCGCTACGAGAGGATAAACGACCGTGACGACGAGGACCACGTCGATGGCACCGTCTCCGAATCGACG
ACGCCTCCGCTCGCCATTCCCAGCTCGCCGCCCCCGTCCTTTCATTCCCGCGCCTCTTCTCCCAGCCGCCGCGGC
GTCGATCCGGCTCTAGCCGATGCCTTCGATGCCGACGATGCCAGTGACGACGATGACGATGCCGACGACAGACAG
CGGCTGGTACGGCAAAACACGACACCGAGCACCAGCTGTGCGACGCCGCCGACGGGTGCGCCTGCACAGTCGACC
GATGCCCCCGCCGTCTCGTCCGGGTCACGGCCGCGGTACGTGGGAGGCGGCGTCGGCACCGATGGCGTCTTCGCC
AACCTGTCGGCGCGGCCGGAACGCGTAGACTCGGAGAAGGAGGAACAGCCACCGACGTACGAGCAGGCGGCCGCC
GACGCCGCACCGCCCTACTGGGAGACGACCATCTTGGCGCCCGGCTTCGGCGGGCCCGACGAGGTGTACGTCGAC
GGCCTACCGGTCGGATCCGTCTTCTCCTTCATCTGGAACGGCATGATCTCGACGTCGTTCCAGCTCGTCGGCTTC
CTCCTCACCTACCTGCTGCACTCGACGCACGCGGCCAAGAACGGGTCCCGCGCCGGCCTGGGTATTACGCTGATC
CAGTACGGCTTCTACATGAAGGGCACGTCCGAGGGCGAGCCGCCGTCGATGAGCGGCCCCGACGGCTACGCGGCC
CCGCCCGACCCCAACTCTCACGAGTTCGACCCGGGTGAGGTGGCCGACGGCGGCAGCGGCGGCGGCTCGGCCATC
ACGGGCGGCGAGTGGATGTCGTACGTCCTCATGGTCGTCGGCTGGTTCATCCTGATCAAAAGCGTGGCCGAGTAC
CTGAGGGCCCGCCGCCACGAGCAGCTGGTGATGCAGAGCCCCGACCGCGGTCTGGGCGTGCCCATCATCGCCGAG
GGCGAGACGGTCGAGCATGTGGTATGA
Transcript >Hirsu2|4638
ATGCCTGGCCGCTACGAGAGGATAAACGACCGTGACGACGAGGACCACGTCGATGGCACCGTCTCCGAATCGACG
ACGCCTCCGCTCGCCATTCCCAGCTCGCCGCCCCCGTCCTTTCATTCCCGCGCCTCTTCTCCCAGCCGCCGCGGC
GTCGATCCGGCTCTAGCCGATGCCTTCGATGCCGACGATGCCAGTGACGACGATGACGATGCCGACGACAGACAG
CGGCTGGTACGGCAAAACACGACACCGAGCACCAGCTGTGCGACGCCGCCGACGGGTGCGCCTGCACAGTCGACC
GATGCCCCCGCCGTCTCGTCCGGGTCACGGCCGCGGTACGTGGGAGGCGGCGTCGGCACCGATGGCGTCTTCGCC
AACCTGTCGGCGCGGCCGGAACGCGTAGACTCGGAGAAGGAGGAACAGCCACCGACGTACGAGCAGGCGGCCGCC
GACGCCGCACCGCCCTACTGGGAGACGACCATCTTGGCGCCCGGCTTCGGCGGGCCCGACGAGGTGTACGTCGAC
GGCCTACCGGTCGGATCCGTCTTCTCCTTCATCTGGAACGGCATGATCTCGACGTCGTTCCAGCTCGTCGGCTTC
CTCCTCACCTACCTGCTGCACTCGACGCACGCGGCCAAGAACGGGTCCCGCGCCGGCCTGGGTATTACGCTGATC
CAGTACGGCTTCTACATGAAGGGCACGTCCGAGGGCGAGCCGCCGTCGATGAGCGGCCCCGACGGCTACGCGGCC
CCGCCCGACCCCAACTCTCACGAGTTCGACCCGGGTGAGGTGGCCGACGGCGGCAGCGGCGGCGGCTCGGCCATC
ACGGGCGGCGAGTGGATGTCGTACGTCCTCATGGTCGTCGGCTGGTTCATCCTGATCAAAAGCGTGGCCGAGTAC
CTGAGGGCCCGCCGCCACGAGCAGCTGGTGATGCAGAGCCCCGACCGCGGTCTGGGCGTGCCCATCATCGCCGAG
GGCGAGACGGTCGAGCATGTGGTATGA
Gene >Hirsu2|4638
ATGCCTGGCCGCTACGAGAGGGTACGTATCTCCGCCTCTGCCCGAAACAACAGCAGCAGAAACGAGGCCGGGCGA
AAACAAAAACAGAAAAAAAGACACGAGGCGACGCTGACGACGGCTCGCAGATAAACGACCGTGACGACGAGGACC
ACGTCGATGGCACCGTCTCCGAATCGACGACGCCTCCGCTCGCCATTCCCAGCTCGCCGCCCCCGTCCTTTCATT
CCCGCGCCTCTTCTCCCAGCCGCCGCGGCGTCGATCCGGCTCTAGCCGATGCCTTCGATGCCGACGATGCCAGTG
ACGACGATGACGATGCCGACGACAGACAGCGGCTGGTACGGCAAAACACGACACCGAGCACCAGCTGTGCGACGC
CGCCGACGGGTGCGCCTGCACAGTCGACCGATGCCCCCGCCGTCTCGTCCGGGTCACGGCCGCGGTACGTGGGAG
GCGGCGTCGGCACCGATGGCGTCTTCGCCAACCTGTCGGCGCGGCCGGAACGCGTAGACTCGGAGAAGGAGGAAC
AGCCACCGGTACGTCAGACTCCTTCTTGTCACCGCCCGAACCGGACGCGACGCTGACCGCCACGCAGACGTACGA
GCAGGCGGCCGCCGACGCCGCACCGCCCTACTGGGAGACGACCATCTTGGCGCCCGGCTTCGGCGGGCCCGACGA
GGTGTACGTCGACGGCCTACCGGTCGGATCCGTCTTCTCCTTCATCTGGAACGGCATGATCTCGACGTCGTTCCA
GCTCGTCGGCTTCCTCCTCACCTACCTGCTGCACTCGACGCACGCGGCCAAGAACGGGTCCCGCGCCGGCCTGGG
TATTACGCTGATCCAGTACGGCTTCTACATGAAGGGCACGTCCGAGGGCGAGCCGCCGTCGATGAGCGGCCCCGA
CGGCTACGCGGCCCCGCCCGACCCCAACTCTCACGAGTTCGACCCGGGTGAGGTGGCCGACGGCGGCAGCGGCGG
CGGCTCGGCCATCACGGGCGGCGAGTGGATGTCGTACGTCCTCATGGTCGTCGGCTGGTTCATCCTGATCAAAAG
CGTGGCCGAGTACCTGAGGGCCCGCCGCCACGAGCAGCTGGTGATGCAGAGCCCCGACCGCGGTCTGGGCGTGCC
CATCATCGCCGAGGGCGAGACGGTCGAGCATGTGGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail