Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4632
Gene name
LocationContig_2344:425..2498
Strand-
Gene length (bp)2073
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 6.9E-12 116 246
PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain 2.8E-12 15 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2U9|GLNA_GIBFU Glutamine synthetase OS=Gibberella fujikuroi GN=GLN1 PE=3 SV=1 2 339 0.0E+00
sp|Q9UUN6|GLNA_FUSSH Glutamine synthetase OS=Fusarium solani subsp. phaseoli GN=GLN1 PE=2 SV=1 2 339 0.0E+00
sp|Q86ZF9|GLNA_NEUCR Glutamine synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gln-1 PE=3 SV=1 2 346 0.0E+00
sp|Q12613|GLNA_COLGL Glutamine synthetase OS=Colletotrichum gloeosporioides GN=GLN1 PE=3 SV=1 2 346 0.0E+00
sp|Q86ZU6|GLNA_TUBBO Glutamine synthetase OS=Tuber borchii GN=GLN1 PE=2 SV=1 4 346 1.0E-175
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2U9|GLNA_GIBFU Glutamine synthetase OS=Gibberella fujikuroi GN=GLN1 PE=3 SV=1 2 339 0.0E+00
sp|Q9UUN6|GLNA_FUSSH Glutamine synthetase OS=Fusarium solani subsp. phaseoli GN=GLN1 PE=2 SV=1 2 339 0.0E+00
sp|Q86ZF9|GLNA_NEUCR Glutamine synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gln-1 PE=3 SV=1 2 346 0.0E+00
sp|Q12613|GLNA_COLGL Glutamine synthetase OS=Colletotrichum gloeosporioides GN=GLN1 PE=3 SV=1 2 346 0.0E+00
sp|Q86ZU6|GLNA_TUBBO Glutamine synthetase OS=Tuber borchii GN=GLN1 PE=2 SV=1 4 346 1.0E-175
sp|Q96V52|GLNA_EMENI Glutamine synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=glnA PE=3 SV=3 4 346 9.0E-175
sp|Q6C3E0|GLNA_YARLI Glutamine synthetase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLN1 PE=3 SV=1 1 346 1.0E-174
sp|Q874T6|GLNA_KLULA Glutamine synthetase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLN1 PE=3 SV=1 1 346 5.0E-174
sp|Q6B4U7|GLNA_DEBHA Glutamine synthetase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLN1 PE=3 SV=1 1 346 2.0E-173
sp|Q75BT9|GLNA_ASHGO Glutamine synthetase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLN1 PE=3 SV=1 4 346 2.0E-171
sp|O00088|GLNA_AGABI Glutamine synthetase OS=Agaricus bisporus GN=glnA PE=3 SV=1 1 345 4.0E-171
sp|P32288|GLNA_YEAST Glutamine synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN1 PE=1 SV=4 1 346 8.0E-171
sp|Q6FMT6|GLNA_CANGA Glutamine synthetase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLN1 PE=3 SV=1 1 346 9.0E-171
sp|Q8X169|GLNA_AMAMU Glutamine synthetase OS=Amanita muscaria GN=GLN1 PE=2 SV=2 1 345 8.0E-169
sp|Q96UV5|GLNA_HEBCY Glutamine synthetase OS=Hebeloma cylindrosporum GN=GLN1 PE=2 SV=1 1 343 1.0E-168
sp|P0CN84|GLNA_CRYNJ Glutamine synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GLN1 PE=2 SV=1 1 341 8.0E-166
sp|P0CN85|GLNA_CRYNB Glutamine synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GLN1 PE=3 SV=1 1 341 8.0E-166
sp|Q09179|GLNA_SCHPO Glutamine synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gln1 PE=1 SV=2 1 343 2.0E-165
sp|Q8J1R3|GLNA_SUIBO Glutamine synthetase OS=Suillus bovinus GN=GLNA PE=3 SV=1 1 345 4.0E-163
sp|P51121|GLNA_XENLA Glutamine synthetase OS=Xenopus laevis GN=glul PE=2 SV=1 4 343 4.0E-151
sp|P16580|GLNA_CHICK Glutamine synthetase OS=Gallus gallus GN=GLUL PE=1 SV=1 5 343 1.0E-147
sp|P41320|GLNA_SQUAC Glutamine synthetase, mitochondrial OS=Squalus acanthias PE=2 SV=1 5 343 5.0E-146
sp|P15104|GLNA_HUMAN Glutamine synthetase OS=Homo sapiens GN=GLUL PE=1 SV=4 5 343 1.0E-144
sp|Q8HZM5|GLNA_CANLF Glutamine synthetase OS=Canis lupus familiaris GN=GLUL PE=1 SV=3 5 343 1.0E-144
sp|Q9QY94|GLNA_ACOCA Glutamine synthetase OS=Acomys cahirinus GN=GLUL PE=2 SV=3 5 343 1.0E-144
sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus GN=GLUL PE=2 SV=4 5 343 2.0E-144
sp|P46410|GLNA_PIG Glutamine synthetase OS=Sus scrofa GN=GLUL PE=2 SV=3 5 343 3.0E-144
sp|P15105|GLNA_MOUSE Glutamine synthetase OS=Mus musculus GN=Glul PE=1 SV=6 5 343 3.0E-144
sp|Q4R7U3|GLNA_MACFA Glutamine synthetase OS=Macaca fascicularis GN=GLUL PE=2 SV=3 5 343 5.0E-143
sp|P09606|GLNA_RAT Glutamine synthetase OS=Rattus norvegicus GN=Glul PE=1 SV=3 5 343 2.0E-141
sp|P20478|GLNA2_DROME Glutamine synthetase 2 cytoplasmic OS=Drosophila melanogaster GN=Gs2 PE=2 SV=3 1 342 1.0E-139
sp|Q04831|GLNA_PANAR Glutamine synthetase OS=Panulirus argus PE=2 SV=1 1 342 1.0E-138
sp|Q43127|GLNA2_ARATH Glutamine synthetase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLN2 PE=1 SV=1 2 343 4.0E-135
sp|P04773|GLNA_CRIGR Glutamine synthetase OS=Cricetulus griseus GN=GLUL PE=2 SV=4 5 343 2.0E-133
sp|P14655|GLNA2_ORYSJ Glutamine synthetase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLN2 PE=1 SV=1 14 338 3.0E-133
sp|P14656|GLN11_ORYSJ Glutamine synthetase cytosolic isozyme 1-1 OS=Oryza sativa subsp. japonica GN=GLN1-1 PE=1 SV=1 9 345 5.0E-133
sp|Q42624|GLNAC_BRANA Glutamine synthetase, chloroplastic OS=Brassica napus GN=GLN2 PE=2 SV=1 2 343 1.0E-132
sp|Q9LVI8|GLN13_ARATH Glutamine synthetase cytosolic isozyme 1-3 OS=Arabidopsis thaliana GN=GLN1-3 PE=1 SV=1 9 344 5.0E-132
sp|O22504|GLNA1_DAUCA Glutamine synthetase cytosolic isozyme OS=Daucus carota GN=GLN1 PE=2 SV=1 9 343 5.0E-132
sp|P25462|GLNAC_MAIZE Glutamine synthetase, chloroplastic OS=Zea mays GN=GLN2 PE=2 SV=1 14 343 8.0E-132
sp|Q42688|GLNA1_CHLRE Glutamine synthetase cytosolic isozyme OS=Chlamydomonas reinhardtii GN=GLN1 PE=2 SV=1 9 343 3.0E-131
sp|O22506|GLNA2_DAUCA Glutamine synthetase, chloroplastic OS=Daucus carota GN=GLN2 PE=2 SV=1 14 343 1.0E-130
sp|Q9XQ94|GLNA2_MEDSA Glutamine synthetase leaf isozyme, chloroplastic OS=Medicago sativa GN=GS2 PE=2 SV=1 13 343 2.0E-130
sp|Q56WN1|GLN11_ARATH Glutamine synthetase cytosolic isozyme 1-1 OS=Arabidopsis thaliana GN=GLN1-1 PE=1 SV=2 9 343 2.0E-130
sp|P38561|GLNA3_MAIZE Glutamine synthetase root isozyme 3 OS=Zea mays GN=GLN4 PE=1 SV=1 9 345 2.0E-130
sp|P13564|GLNA2_HORVU Glutamine synthetase leaf isozyme, chloroplastic OS=Hordeum vulgare PE=2 SV=2 14 343 3.0E-130
sp|P15102|GLNA4_PHAVU Glutamine synthetase leaf isozyme, chloroplastic OS=Phaseolus vulgaris PE=2 SV=1 14 343 4.0E-130
sp|P51119|GLNA2_VITVI Glutamine synthetase cytosolic isozyme 2 OS=Vitis vinifera GN=GS1-2 PE=2 SV=1 9 343 5.0E-130
sp|P12424|GLNA_NICPL Glutamine synthetase OS=Nicotiana plumbaginifolia PE=2 SV=1 9 345 8.0E-130
sp|Q9FMD9|GLN14_ARATH Glutamine synthetase cytosolic isozyme 1-4 OS=Arabidopsis thaliana GN=GLN1-4 PE=1 SV=1 9 343 9.0E-130
sp|P04771|GLNA2_PHAVU Glutamine synthetase PR-2 OS=Phaseolus vulgaris PE=2 SV=1 14 345 1.0E-129
sp|P00965|GLNA3_PHAVU Glutamine synthetase N-1 OS=Phaseolus vulgaris GN=Gln-gamma PE=2 SV=2 9 343 2.0E-129
sp|P04770|GLNA1_PHAVU Glutamine synthetase PR-1 OS=Phaseolus vulgaris PE=2 SV=1 9 345 2.0E-129
sp|P32289|GLNA_VIGAC Glutamine synthetase nodule isozyme OS=Vigna aconitifolia PE=2 SV=1 9 345 2.0E-129
sp|P20477|GLNA1_DROME Glutamine synthetase 1, mitochondrial OS=Drosophila melanogaster GN=Gs1 PE=2 SV=3 1 343 3.0E-129
sp|Q43785|GLNA3_MEDSA Glutamine synthetase nodule isozyme OS=Medicago sativa GN=GS1 PE=2 SV=1 14 343 3.0E-129
sp|Q42899|GLNA1_LOTJA Glutamine synthetase cytosolic isozyme OS=Lotus japonicus GN=GLN1 PE=2 SV=2 14 345 3.0E-129
sp|Q43066|GLNA4_PEA Glutamine synthetase root isozyme B OS=Pisum sativum GN=GS3B PE=3 SV=1 9 345 4.0E-129
sp|P52782|GLNA_LUPLU Glutamine synthetase nodule isozyme OS=Lupinus luteus PE=3 SV=1 9 343 5.0E-129
sp|P34497|GLNA_CAEEL Probable glutamine synthetase OS=Caenorhabditis elegans GN=gln-2 PE=3 SV=1 1 343 7.0E-129
sp|P07694|GLNA3_PEA Glutamine synthetase root isozyme A OS=Pisum sativum GN=GS3A PE=2 SV=1 9 345 8.0E-129
sp|P04078|GLNA1_MEDSA Glutamine synthetase cytosolic isozyme OS=Medicago sativa PE=2 SV=1 14 345 9.0E-129
sp|P38563|GLNA5_MAIZE Glutamine synthetase root isozyme 5 OS=Zea mays GN=GS1-5 PE=2 SV=2 9 345 1.0E-128
sp|P08281|GLNA2_PEA Glutamine synthetase leaf isozyme, chloroplastic OS=Pisum sativum GN=GS2 PE=2 SV=2 13 343 2.0E-128
sp|Q4W8D0|GLN13_ORYSJ Glutamine synthetase cytosolic isozyme 1-3 OS=Oryza sativa subsp. japonica GN=GLN1-3 PE=2 SV=1 14 343 3.0E-128
sp|O82560|GLNA2_SOYBN Glutamine synthetase cytosolic isozyme 2 OS=Glycine max PE=1 SV=1 9 345 3.0E-128
sp|Q8GXW5|GLN15_ARATH Glutamine synthetase cytosolic isozyme 1-5 OS=Arabidopsis thaliana GN=GLN1-5 PE=1 SV=1 14 343 4.0E-128
sp|P38559|GLNA1_MAIZE Glutamine synthetase root isozyme 1 OS=Zea mays GN=GLN6 PE=2 SV=1 9 343 8.0E-128
sp|P23712|GLNA_LACSA Glutamine synthetase OS=Lactuca sativa PE=2 SV=2 14 343 2.0E-127
sp|Q06378|GLNA3_HORVU Glutamine synthetase OS=Hordeum vulgare PE=2 SV=1 14 345 3.0E-127
sp|P51118|GLNA1_VITVI Glutamine synthetase cytosolic isozyme 1 OS=Vitis vinifera GN=GS1-1 PE=2 SV=1 14 345 1.0E-126
sp|P38562|GLNA4_MAIZE Glutamine synthetase root isozyme 4 OS=Zea mays GN=GLN5 PE=2 SV=1 9 343 2.0E-126
sp|P08282|GLNA1_PEA Glutamine synthetase nodule isozyme OS=Pisum sativum GN=GS1 PE=2 SV=2 2 345 2.0E-126
sp|P14654|GLN12_ORYSJ Glutamine synthetase cytosolic isozyme 1-2 OS=Oryza sativa subsp. japonica GN=GLN1-2 PE=1 SV=1 9 343 2.0E-126
sp|Q8LCE1|GLN12_ARATH Glutamine synthetase cytosolic isozyme 1-2 OS=Arabidopsis thaliana GN=GLN1-2 PE=1 SV=2 9 343 3.0E-126
sp|O04867|GLNA1_ALNGL Glutamine synthetase OS=Alnus glutinosa GN=GLN1 PE=2 SV=1 9 343 2.0E-125
sp|P52783|GLNA_PINSY Glutamine synthetase cytosolic isozyme OS=Pinus sylvestris PE=2 SV=1 9 345 4.0E-125
sp|P24099|GLNA1_SOYBN Glutamine synthetase cytosolic isozyme 1 OS=Glycine max PE=2 SV=1 9 345 1.0E-123
sp|P38560|GLNA2_MAIZE Glutamine synthetase root isozyme 2 OS=Zea mays GN=GLN2 PE=2 SV=1 1 343 6.0E-123
sp|Q5UR44|GLNA_MIMIV Putative glutamine synthetase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R565 PE=3 SV=1 9 342 5.0E-115
sp|P14636|GLNA3_LUPAN Glutamine synthetase nodule isozyme (Fragment) OS=Lupinus angustifolius PE=2 SV=1 9 306 5.0E-112
sp|Q42689|GLNA2_CHLRE Glutamine synthetase, chloroplastic OS=Chlamydomonas reinhardtii GN=GLN2 PE=2 SV=1 10 343 7.0E-112
sp|P19432|GLNA2_STRVR Glutamine synthetase 2 OS=Streptomyces viridochromogenes GN=glnII PE=3 SV=1 16 346 6.0E-110
sp|P22878|GLNA2_STRHY Glutamine synthetase 2 OS=Streptomyces hygroscopicus GN=glnB PE=3 SV=1 13 346 4.0E-99
sp|P20805|GLNA2_FRAAL Glutamine synthetase 2 OS=Frankia alni GN=glnII PE=2 SV=1 16 346 8.0E-99
sp|P04772|GLNA2_BRADU Glutamine synthetase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glnII PE=3 SV=2 17 342 6.0E-90
sp|P11600|GLNA_DUNSA Glutamine synthetase (Fragment) OS=Dunaliella salina PE=2 SV=1 116 343 5.0E-87
sp|Q02154|GLNA2_RHILP Glutamine synthetase 2 OS=Rhizobium leguminosarum bv. phaseoli GN=glnII PE=1 SV=3 17 336 2.0E-82
sp|P45626|GLNA2_RHIML Glutamine synthetase 2 OS=Rhizobium meliloti GN=glnII PE=3 SV=1 17 334 4.0E-80
sp|Q60182|GLNA_METJA Glutamine synthetase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glnA PE=3 SV=1 46 245 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0006542 glutamine biosynthetic process Yes
GO:1901607 alpha-amino acid biosynthetic process No
GO:0008152 metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0016211 ammonia ligase activity No
GO:0044238 primary metabolic process No
GO:0006541 glutamine metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901605 alpha-amino acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006082 organic acid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4632
MVNKYMKLDQKGNIMAEYVWIDAAGEVRSKSRTLEEKEYKPAELPIWNFDGSSTEQAPGDNSDVYLRPCAVFPDP
FRGSPNIIVLSECWNADGTPNKYNFRHECNKVMEAYAEHIPWFGLEQEYTLLGHDDRPYGWPNGGYPAPQGPYYC
GVGSGKVVMRDVVESHYKACLYAGVNISGTNAEVMPGQWEFQVGPCEGIQMGDHLWMARFFLARVAEDFGVKVSW
HPKPIRGNWNGAGLHSNFSTKEMRAEGGMKHIQDALKKLEPHHEDCIKEYGEDNDQRLTGLHETGSIEKFTYGVA
NRGTSIRIPRETAAKGYGYFEDRRPASNADPYRVTRVLMTSIFGKL*
Coding >Hirsu2|4632
ATGGTCAACAAATACATGAAGCTCGACCAGAAGGGCAACATCATGGCCGAGTATGTCTGGATCGATGCCGCCGGC
GAGGTCCGGTCCAAGTCGAGGACGCTCGAGGAAAAGGAGTACAAGCCGGCCGAGCTGCCCATCTGGAACTTTGAC
GGCTCCTCGACCGAACAGGCGCCCGGCGACAACTCGGACGTCTACCTCCGCCCCTGCGCCGTCTTCCCCGACCCC
TTCCGCGGCTCGCCCAACATCATCGTGCTGAGCGAGTGCTGGAACGCCGATGGCACCCCCAACAAGTACAACTTC
CGCCACGAGTGCAACAAGGTCATGGAGGCCTATGCCGAGCACATTCCCTGGTTCGGTCTCGAGCAAGAATACACC
CTCCTCGGCCACGATGACCGACCCTACGGCTGGCCCAACGGCGGTTACCCTGCACCGCAAGGCCCGTACTACTGC
GGCGTTGGCAGCGGCAAGGTGGTAATGCGCGACGTCGTCGAGTCCCACTACAAGGCCTGCCTGTATGCCGGCGTT
AACATCTCCGGAACCAATGCCGAGGTCATGCCCGGCCAGTGGGAGTTCCAGGTTGGCCCCTGCGAGGGCATCCAA
ATGGGCGATCACCTTTGGATGGCCCGATTCTTCCTGGCCCGCGTCGCCGAGGACTTTGGCGTCAAGGTCTCGTGG
CACCCCAAGCCGATCCGCGGCAACTGGAACGGCGCGGGCCTGCACTCCAACTTCTCGACCAAGGAGATGCGGGCT
GAGGGCGGCATGAAGCACATCCAGGATGCGCTCAAGAAGCTGGAGCCGCACCACGAGGACTGCATCAAGGAGTAC
GGCGAGGACAACGACCAGCGGTTGACGGGGCTCCACGAGACGGGCTCTATCGAGAAGTTCACGTACGGTGTCGCC
AACCGAGGCACATCGATCCGCATCCCCCGGGAGACGGCCGCCAAGGGCTACGGATACTTTGAGGACCGTCGCCCG
GCCTCCAACGCCGACCCGTACCGCGTCACGCGCGTGCTGATGACGTCCATATTCGGCAAGCTGTAG
Transcript >Hirsu2|4632
ATGGTCAACAAATACATGAAGCTCGACCAGAAGGGCAACATCATGGCCGAGTATGTCTGGATCGATGCCGCCGGC
GAGGTCCGGTCCAAGTCGAGGACGCTCGAGGAAAAGGAGTACAAGCCGGCCGAGCTGCCCATCTGGAACTTTGAC
GGCTCCTCGACCGAACAGGCGCCCGGCGACAACTCGGACGTCTACCTCCGCCCCTGCGCCGTCTTCCCCGACCCC
TTCCGCGGCTCGCCCAACATCATCGTGCTGAGCGAGTGCTGGAACGCCGATGGCACCCCCAACAAGTACAACTTC
CGCCACGAGTGCAACAAGGTCATGGAGGCCTATGCCGAGCACATTCCCTGGTTCGGTCTCGAGCAAGAATACACC
CTCCTCGGCCACGATGACCGACCCTACGGCTGGCCCAACGGCGGTTACCCTGCACCGCAAGGCCCGTACTACTGC
GGCGTTGGCAGCGGCAAGGTGGTAATGCGCGACGTCGTCGAGTCCCACTACAAGGCCTGCCTGTATGCCGGCGTT
AACATCTCCGGAACCAATGCCGAGGTCATGCCCGGCCAGTGGGAGTTCCAGGTTGGCCCCTGCGAGGGCATCCAA
ATGGGCGATCACCTTTGGATGGCCCGATTCTTCCTGGCCCGCGTCGCCGAGGACTTTGGCGTCAAGGTCTCGTGG
CACCCCAAGCCGATCCGCGGCAACTGGAACGGCGCGGGCCTGCACTCCAACTTCTCGACCAAGGAGATGCGGGCT
GAGGGCGGCATGAAGCACATCCAGGATGCGCTCAAGAAGCTGGAGCCGCACCACGAGGACTGCATCAAGGAGTAC
GGCGAGGACAACGACCAGCGGTTGACGGGGCTCCACGAGACGGGCTCTATCGAGAAGTTCACGTACGGTGTCGCC
AACCGAGGCACATCGATCCGCATCCCCCGGGAGACGGCCGCCAAGGGCTACGGATACTTTGAGGACCGTCGCCCG
GCCTCCAACGCCGACCCGTACCGCGTCACGCGCGTGCTGATGACGTCCATATTCGGCAAGCTGTAG
Gene >Hirsu2|4632
ATGGTACGTCACCTCGCCCGAACCACCACCACCACCACCACACTCGTCGCCGCCCAATCATGAGCGGAACCACCC
TCTTTTCTGTCTCCTCGACTCTTCTTACTAATCGCTCTTCCGGTGTAGGCCAGTCGCGAAGTTCTCTCCTCCAGG
ACGGAGACCGTACGACTCCCTCGTGCCCCGAGAGGCCGTCGTCATGGAGCGCCCCGGCTGACGGGCTGATGCCCC
CAACAGGTCAACAAATACATGAAGCTCGACCAGAAGGGCAACATCATGGCCGAGTATGTCTGGATCGATGCCGCC
GGCGAGGTCCGGTCCAAGTCGAGGGTGAGTTGCACGCGGCCCGCCACCCTAGGCGCCCTTTTCCTTTTCGGCTTT
TTTTTTTGTCTCTGTCCACCTCGATCTGCGACATTGGCCAAGCACTCCGGTTCGAGGTGGCCATGTCAGCCATCG
TGGCTGCATTCGCAGGCTTCGACCATCTCGTCTTCGTCGACCGCCACGGCTCCATCCGGCTGCGTGCTGCCTGCA
TAAGCACTTGTCGCCACTGCCACCGCATGCGCCACGCTCGTACCCATTCACGTCAGCAGCGTCGCATCGCCACCC
TCAGTCCCACAGCCCTGACCTGATTCGAGCTGTGGCGCCCGGCCAACCAAACCACGCCACTCCCCCCCCAATAGC
GGTGCCGCCTATGACGACGACCTCGACAGATGCGTTACACGAGCCGTCAATTCGTTCCCGCCCTCTCCGGCCCTT
TGGACCGCTCGCCGACGGCGCCAACACGACCCTTCCCCTTGCAACGACCCTGGACGCCGTGACGTGACAGTTGGC
CAATATGGGACGTCGTTCAGATCGGGCTAACGACAGTCAATCGCGCAGACGCTCGAGGAAAAGGAGTACAAGCCG
GCCGAGCTGCCCATCTGGAACTTTGACGGCTCCTCGACCGAACAGGCGCCCGGCGACAACTCGGACGTCTACCTC
CGCCCCTGCGCCGTCTTCCCCGACCCCTTCCGCGGCTCGCCCAACATCATCGTGCTGAGCGAGTGCTGGAACGCC
GATGGCACCCCCAACAAGTACAACTTCCGCCACGAGTGCAACAAGGTCATGGAGGCCTATGCCGAGCACATTCCC
TGGTTCGGTCTCGAGCAAGAATACACCCTCCTCGGCCACGATGACCGACCCTACGGCTGGCCCAACGGCGGTTAC
CCTGCACCGTAAGAAGACACCGTCCCTTGTCCTCCCCGGTTCCGCATCTCGCGCTTCACCGTGTGGTGTCGCGCA
CATGGCGCCGTGGTCCTCTCCGTTACACGCGCCCCGCTAACGCCGCCCTCCACCCACAATCAGGCAAGGCCCGTA
CTACTGCGGCGTTGGCAGCGGCAAGGTGGTAATGCGCGACGTCGTCGAGTCCCACTACAAGGCCTGCCTGTGTAA
GTTGTCGTCCGTCTGGTGGGCTGATGTCACGAGACGACTGTGCTGACGGTTACGCGCGCCAGATGCCGGCGTTAA
CATCTCCGGAACCAATGCCGAGGTCATGCCCGGCCAGTGGGAGTTCCAGGTTGGCCCCTGCGAGGGCATCCAAAG
TAGGTCGATGTCGGCGCCGTCCGGAGCGAGGGGCCGCGATGCTGACTAGCGGCAACAGTGGGCGATCACCTTTGG
ATGGCCCGATTCTTCCTGGCCCGCGTCGCCGAGGACTTTGGCGTCAAGGTCTCGTGGCACCCCAAGCCGATCCGC
GGCAACTGGAACGGCGCGGGCCTGCACTCCAACTTCTCGACCAAGGAGATGCGGGCTGAGGGCGGCATGAAGCAC
ATCCAGGATGCGCTCAAGAAGCTGGAGCCGCACCACGAGGACTGCATCAAGGAGTACGGCGAGGACAACGACCAG
CGGTTGACGGGGCTCCACGAGACGGGCTCTATCGAGAAGTTCACGTACGGTGTCGCCAACCGAGGCACATCGATC
CGCATCCCCCGGGAGACGGCCGCCAAGGGCTACGGATACTTTGAGGACCGTCGCCCGGCCTCCAACGCCGACCCG
TACCGCGTCACGCGCGTGCTGATGACGTCCATATTCGGCAAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail