Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4631
Gene name
LocationContig_2343:742..2130
Strand+
Gene length (bp)1388
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 9.3E-06 143 198

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03973|HMO1_YEAST High mobility group protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMO1 PE=1 SV=1 113 202 6.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3788 0.9281 0.1182 0.0142 0.0893 0.0123 0.04 0.0359 0.0706 0.0747

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2478
Ophiocordyceps australis map64 (Brazil) OphauB2|9
Ophiocordyceps camponoti-floridani Ophcf2|02327
Ophiocordyceps camponoti-rufipedis Ophun1|6578
Ophiocordyceps kimflemingae Ophio5|4336
Ophiocordyceps subramaniannii Hirsu2|4631 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4631
MPRPAKKADDKAKVPVVAAAPAPAPTMVPPPTAAVMPAPPVPVGAPVPMLSTRVVDNDSFMRVRDSAVGRLNTIL
ELLRSFTADYVRQTNLLMGEPTAEPGQGDLLSSFENAAAQLILPVPDMAPPVEEKKERKKRTHDPNAPKRPLTPY
FLYMQHARSIIANDLGADAPKGAVQEEGQRRWAHMSPNEKKGWNAAYQYNLRLT*
Coding >Hirsu2|4631
ATGCCTCGTCCGGCCAAGAAGGCCGACGACAAGGCCAAAGTGCCTGTTGTCGCCGCCGCGCCCGCTCCAGCGCCC
ACCATGGTGCCGCCTCCCACGGCGGCCGTCATGCCCGCGCCCCCGGTGCCTGTTGGAGCTCCGGTGCCCATGCTC
AGCACGCGCGTGGTCGACAATGACAGCTTCATGCGCGTCCGCGACTCGGCCGTCGGTCGCCTCAACACCATCCTC
GAGCTGCTGCGCTCCTTCACCGCCGACTATGTGCGCCAGACCAACCTGCTCATGGGCGAGCCCACGGCCGAGCCC
GGCCAGGGCGACCTGCTCAGCTCGTTTGAGAACGCGGCGGCCCAGCTGATCCTGCCCGTGCCGGACATGGCGCCG
CCGGTCGAGGAGAAGAAGGAGCGCAAGAAGCGGACGCACGACCCCAACGCGCCCAAGCGCCCGCTCACCCCCTAC
TTCCTCTACATGCAGCACGCCCGCTCCATCATCGCCAACGACCTGGGTGCCGACGCGCCCAAGGGCGCTGTCCAG
GAGGAGGGCCAGCGCCGCTGGGCGCACATGAGCCCCAACGAGAAGAAGGGCTGGAACGCGGCGTACCAGTACAAC
CTGCGCCTAACATGA
Transcript >Hirsu2|4631
ATGCCTCGTCCGGCCAAGAAGGCCGACGACAAGGCCAAAGTGCCTGTTGTCGCCGCCGCGCCCGCTCCAGCGCCC
ACCATGGTGCCGCCTCCCACGGCGGCCGTCATGCCCGCGCCCCCGGTGCCTGTTGGAGCTCCGGTGCCCATGCTC
AGCACGCGCGTGGTCGACAATGACAGCTTCATGCGCGTCCGCGACTCGGCCGTCGGTCGCCTCAACACCATCCTC
GAGCTGCTGCGCTCCTTCACCGCCGACTATGTGCGCCAGACCAACCTGCTCATGGGCGAGCCCACGGCCGAGCCC
GGCCAGGGCGACCTGCTCAGCTCGTTTGAGAACGCGGCGGCCCAGCTGATCCTGCCCGTGCCGGACATGGCGCCG
CCGGTCGAGGAGAAGAAGGAGCGCAAGAAGCGGACGCACGACCCCAACGCGCCCAAGCGCCCGCTCACCCCCTAC
TTCCTCTACATGCAGCACGCCCGCTCCATCATCGCCAACGACCTGGGTGCCGACGCGCCCAAGGGCGCTGTCCAG
GAGGAGGGCCAGCGCCGCTGGGCGCACATGAGCCCCAACGAGAAGAAGGGCTGGAACGCGGCGTACCAGTACAAC
CTGCGCCTAACATGA
Gene >Hirsu2|4631
ATGCCTCGTCCGGCCAAGAAGGCCGACGACAAGGCCAAAGTGCCTGTTGTCGCCGCCGCGCCCGCTCCAGCGCCC
ACCATGGTGCCGCCTCCCACGGCGGCCGTCATGCCCGCGCCCCCGGTGCCTGTTGGAGCTCCGGTGCCCATGCTC
AGCACGCGCGTGGTCGACAATGACAGCTTCATGCGCGTCCGCGACTCGGTCAGTTCTGATTTCTTTTTTTGTCGG
CTCCCTCGTCGCGTGCGCCGCCTTGGTCTCCTCCGGGCGGCAGAAACAGCACGCTCTCTCTCGCCTTCATCCGCC
TGCTTTTTCTTGGCCTCGCGGGCGGGCTGCGCCGTCGGACCGCGTCCGCGCGTCGGCTCCGGCCTCTTGCCTCTG
TGCCACTCGCTCGTCGTTGCACCGCGAGCTCGACGCATTGCCGCGAGAGCCTGGCCTCGCACCCGCCGTCATCAT
GCCGTCCAACCCATGCACTGCACAAGAACAGAGGCCGTCTTGTCACGACGCTGCCCCGCACACAGCTTGCTGCCT
CTGCGACGCGCCTCGGCGACAGAAAGCAAGCTGTTCGCCCCCTCCCCGCCGCATTTGTTTACATCCAATCCCGCG
CCGCCCTCGCCCAGCCCCCAGCCCCCCCCCCCCAGCTCGAGCGCTCCAGCGGCTCCCGCCTCTGGTCTCGCTACT
GGCCCGTCGCCTCCTCAGCGGGAGCCGCCAGCGCGCACGCGACGGCCCACCCGACGACTTGCACTACCGTCCCGG
GCCTTCAGCGGGCCGCCCCATGGCTCCCGAAGCCGGTCCCCTGCCGTTCGCCACGCGTCCTCCCCGTGCGCCGGA
CGCCCTGGCTGACCATTGTTTCGTCGCGCATCGCAGGCCGTCGGTCGCCTCAACACCATCCTCGAGCTGCTGCGC
TCCTTCACCGCCGACTATGTGCGCCAGACCAACCTGCTCATGGGCGAGCCCACGGCCGAGCCCGGCCAGGGCGAC
CTGCTCAGCTCGTTTGAGAACGCGGCGGCCCAGCTGATCCTGCCCGTGCCGGACATGGCGCCGCCGGTCGAGGAG
AAGAAGGAGCGCAAGAAGCGGACGCACGACCCCAACGCGCCCAAGCGCCCGCTCACCCCCTACTTCCTCTACATG
CAGCACGCCCGCTCCATCATCGCCAACGACCTGGGTGCCGACGCGCCCAAGGGCGCTGTCCAGGAGGAGGGCCAG
CGCCGCTGGGCGCACATGAGCCCCAACGAGAAGAAGGTGAGCCGGCCCCGTGCACAGCTTCCCCCCCCTGGCCCC
GCTGACGGGCGCGCACCCCCAGGGCTGGAACGCGGCGTACCAGTACAACCTGCGCCTGTACAACGCGCGCGTCCA
CTCGTACAAGGCCGGCAACCCACTGGCCAAGAACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail