Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4625
Gene name
LocationContig_234:23423..25366
Strand-
Gene length (bp)1943
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-17 129 393
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-10 429 557

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46996|YJQ3_YEAST Uncharacterized membrane protein YJL163C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL163C PE=1 SV=1 143 547 9.0E-23
sp|O13714|YDZ7_SCHPO Uncharacterized membrane protein C14C4.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC14C4.07 PE=1 SV=1 77 567 2.0E-18
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 150 538 2.0E-12
sp|Q7ZWG6|PCFT_DANRE Proton-coupled folate transporter OS=Danio rerio GN=slc46a1 PE=2 SV=1 126 519 1.0E-06
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 129 252 4.0E-06

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1601 0.0994 0.0859 0.111 0.2998 0.0036 0.2524 0.752 0.2461 0.3499

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 65 84 19
2 131 153 22
3 165 184 19
4 194 216 22
5 229 251 22
6 261 283 22
7 345 367 22
8 382 404 22
9 434 453 19
10 458 480 22
11 493 515 22
12 525 544 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup715
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3223
Ophiocordyceps australis map64 (Brazil) OphauB2|3870
Ophiocordyceps camponoti-floridani Ophcf2|04134
Ophiocordyceps camponoti-rufipedis Ophun1|1203
Ophiocordyceps kimflemingae Ophio5|7024
Ophiocordyceps subramaniannii Hirsu2|1606
Ophiocordyceps subramaniannii Hirsu2|4625 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4625
MGGAHPARPRPAHPEPEVAETDRLLERGPRRRPGHEPGDDADSIGCRWTGFQDFALLPWWRKPSVLWLLAPFTLF
TLAFGGIIVPKLNLILDLVCQRYFSDESRGGVHGGRPVVLGGDNPQCRIPEVHKDVATFMLVINFVTGGLSAVVA
PKLGHLSDRYGRRRLLALASCGGLLAELITILAAKFPQAVDYRWMVLGAVFDGMTGSFTAGSLLSQSYTSDCTPP
SKRAVSMGYIQACLFVGLAFGPLLAGYFVKWTGSLVSIFYVALGCHTFFVLFVGLVIPESLSAKRQAAARDKWQK
EKEARALHVGSWLSTLLSSNPLAPLQILWPTGPGTSTRLRLNLVALATCDAIIFGAAFAVGPVIMLYAEYMFNWG
NFETSRFISALSMARVVVLMGLFPAINYFGRVRPAARRHARLGTTPVERNFGADRLDVWIVRLALVWEVLGCLGY
ALGRSQELFILCGMVTALGGLGSATIQAAVTKQVPTGRVGQILGAVGMMHALARIVGPVVFNGIYAATVATFPQA
VFLALCGLFVVALVVSLVVKPYVHWEETHDDEGEEEPLNRTQQLFDTTADTLPVDEGQVRVQ*
Coding >Hirsu2|4625
ATGGGCGGCGCGCACCCGGCAAGGCCGCGGCCTGCCCACCCCGAGCCCGAGGTGGCGGAAACGGACCGTCTGCTC
GAGCGCGGCCCCCGGCGACGACCGGGCCACGAGCCCGGCGACGATGCCGACTCCATCGGCTGCCGCTGGACCGGT
TTCCAGGACTTTGCCCTCCTGCCTTGGTGGCGCAAGCCTTCGGTCCTGTGGCTGCTCGCGCCATTCACGCTCTTC
ACCCTAGCCTTTGGCGGCATCATAGTCCCCAAGCTTAATCTGATCCTGGACCTCGTCTGCCAGCGCTACTTCTCC
GACGAGAGCCGCGGCGGCGTCCATGGCGGCCGCCCCGTCGTCCTCGGCGGCGACAACCCGCAGTGCCGGATCCCC
GAGGTGCACAAGGACGTGGCGACCTTCATGCTCGTCATCAACTTCGTCACGGGCGGCCTCAGTGCCGTCGTCGCG
CCCAAGCTGGGCCACCTGTCGGACCGCTACGGCCGGCGGCGGCTGCTGGCCCTGGCCTCGTGCGGCGGCCTCCTG
GCCGAGCTCATCACCATCCTGGCCGCCAAGTTCCCCCAGGCCGTCGACTACCGCTGGATGGTGCTGGGGGCCGTC
TTCGACGGCATGACCGGCTCCTTCACCGCCGGCAGCCTGCTCAGCCAGTCGTACACGAGCGACTGCACGCCGCCC
TCCAAGCGGGCCGTGTCCATGGGCTACATCCAGGCCTGCCTGTTCGTCGGCCTCGCCTTCGGGCCGCTGCTGGCC
GGCTACTTCGTCAAGTGGACCGGCAGCCTCGTGTCCATCTTCTACGTCGCCCTCGGCTGCCACACCTTCTTCGTC
CTCTTCGTCGGCCTCGTCATCCCCGAGTCGCTGTCGGCCAAGAGGCAGGCCGCGGCGCGGGACAAGTGGCAGAAG
GAGAAGGAGGCGCGCGCCCTGCACGTCGGCTCCTGGCTGTCGACGCTGCTCTCCTCGAACCCCCTGGCGCCGCTG
CAGATCCTGTGGCCGACGGGGCCGGGGACGTCGACGCGGCTGCGTCTCAACCTGGTGGCGCTGGCGACGTGCGAC
GCCATCATCTTCGGGGCCGCCTTCGCCGTCGGGCCCGTCATCATGCTGTACGCCGAGTACATGTTCAACTGGGGC
AACTTTGAGACGTCTCGCTTCATCTCGGCCCTGTCCATGGCGCGCGTCGTCGTCCTGATGGGCCTCTTCCCCGCC
ATCAACTACTTTGGCCGCGTCCGGCCGGCGGCTCGGCGGCACGCGCGGCTGGGCACGACGCCCGTGGAGCGCAAC
TTCGGGGCGGACCGGCTCGACGTCTGGATCGTCCGGCTCGCGCTGGTCTGGGAGGTGCTGGGATGCCTGGGCTAC
GCGCTCGGGCGGTCGCAGGAGCTGTTCATCCTCTGCGGCATGGTGACGGCGCTCGGCGGACTCGGGAGCGCCACT
ATCCAGGCCGCGGTGACGAAGCAGGTGCCTACGGGACGCGTGGGCCAGATCCTCGGTGCCGTCGGCATGATGCAC
GCGCTGGCCCGGATCGTCGGGCCCGTCGTCTTCAACGGAATCTACGCCGCCACCGTCGCCACCTTTCCGCAGGCC
GTCTTCCTCGCCCTCTGCGGCCTCTTTGTCGTCGCTCTCGTCGTCAGCCTCGTCGTCAAGCCATACGTCCACTGG
GAGGAGACCCACGACGACGAGGGGGAGGAGGAGCCGCTGAACCGGACGCAGCAGCTGTTCGACACGACCGCGGAC
ACGCTGCCCGTCGACGAGGGTCAAGTCCGCGTCCAATAG
Transcript >Hirsu2|4625
ATGGGCGGCGCGCACCCGGCAAGGCCGCGGCCTGCCCACCCCGAGCCCGAGGTGGCGGAAACGGACCGTCTGCTC
GAGCGCGGCCCCCGGCGACGACCGGGCCACGAGCCCGGCGACGATGCCGACTCCATCGGCTGCCGCTGGACCGGT
TTCCAGGACTTTGCCCTCCTGCCTTGGTGGCGCAAGCCTTCGGTCCTGTGGCTGCTCGCGCCATTCACGCTCTTC
ACCCTAGCCTTTGGCGGCATCATAGTCCCCAAGCTTAATCTGATCCTGGACCTCGTCTGCCAGCGCTACTTCTCC
GACGAGAGCCGCGGCGGCGTCCATGGCGGCCGCCCCGTCGTCCTCGGCGGCGACAACCCGCAGTGCCGGATCCCC
GAGGTGCACAAGGACGTGGCGACCTTCATGCTCGTCATCAACTTCGTCACGGGCGGCCTCAGTGCCGTCGTCGCG
CCCAAGCTGGGCCACCTGTCGGACCGCTACGGCCGGCGGCGGCTGCTGGCCCTGGCCTCGTGCGGCGGCCTCCTG
GCCGAGCTCATCACCATCCTGGCCGCCAAGTTCCCCCAGGCCGTCGACTACCGCTGGATGGTGCTGGGGGCCGTC
TTCGACGGCATGACCGGCTCCTTCACCGCCGGCAGCCTGCTCAGCCAGTCGTACACGAGCGACTGCACGCCGCCC
TCCAAGCGGGCCGTGTCCATGGGCTACATCCAGGCCTGCCTGTTCGTCGGCCTCGCCTTCGGGCCGCTGCTGGCC
GGCTACTTCGTCAAGTGGACCGGCAGCCTCGTGTCCATCTTCTACGTCGCCCTCGGCTGCCACACCTTCTTCGTC
CTCTTCGTCGGCCTCGTCATCCCCGAGTCGCTGTCGGCCAAGAGGCAGGCCGCGGCGCGGGACAAGTGGCAGAAG
GAGAAGGAGGCGCGCGCCCTGCACGTCGGCTCCTGGCTGTCGACGCTGCTCTCCTCGAACCCCCTGGCGCCGCTG
CAGATCCTGTGGCCGACGGGGCCGGGGACGTCGACGCGGCTGCGTCTCAACCTGGTGGCGCTGGCGACGTGCGAC
GCCATCATCTTCGGGGCCGCCTTCGCCGTCGGGCCCGTCATCATGCTGTACGCCGAGTACATGTTCAACTGGGGC
AACTTTGAGACGTCTCGCTTCATCTCGGCCCTGTCCATGGCGCGCGTCGTCGTCCTGATGGGCCTCTTCCCCGCC
ATCAACTACTTTGGCCGCGTCCGGCCGGCGGCTCGGCGGCACGCGCGGCTGGGCACGACGCCCGTGGAGCGCAAC
TTCGGGGCGGACCGGCTCGACGTCTGGATCGTCCGGCTCGCGCTGGTCTGGGAGGTGCTGGGATGCCTGGGCTAC
GCGCTCGGGCGGTCGCAGGAGCTGTTCATCCTCTGCGGCATGGTGACGGCGCTCGGCGGACTCGGGAGCGCCACT
ATCCAGGCCGCGGTGACGAAGCAGGTGCCTACGGGACGCGTGGGCCAGATCCTCGGTGCCGTCGGCATGATGCAC
GCGCTGGCCCGGATCGTCGGGCCCGTCGTCTTCAACGGAATCTACGCCGCCACCGTCGCCACCTTTCCGCAGGCC
GTCTTCCTCGCCCTCTGCGGCCTCTTTGTCGTCGCTCTCGTCGTCAGCCTCGTCGTCAAGCCATACGTCCACTGG
GAGGAGACCCACGACGACGAGGGGGAGGAGGAGCCGCTGAACCGGACGCAGCAGCTGTTCGACACGACCGCGGAC
ACGCTGCCCGTCGACGAGGGTCAAGTCCGCGTCCAATAG
Gene >Hirsu2|4625
ATGGGCGGCGCGCACCCGGCAAGGCCGCGGCCTGCCCACCCCGAGCCCGAGGTGGCGGAAACGGACCGTCTGCTC
GAGCGCGGCCCCCGGCGACGACCGGGCCACGAGCCCGGCGACGATGCCGACTCCATCGGCTGCCGCTGGACCGGT
TTCCAGGACTTTGCCCTCCTGCCTTGGTGGCGCAAGCCTTCGGTATGCGGTCCATCATTGGTCGAACGGTAACCG
GGAGGAAGAAACAAGACTAAAACGCTCGCGCAGGTCCTGTGGCTGCTCGCGCCATTCACGCTCTTCACCCTAGCC
TTTGGCGGCATCATAGTCCCCAAGCTTAATCTGTAAAGCACCGCCCCCTCCCGGCGCGTGGGAGCATCGCTGACG
GCGGCGGCCCAGGATCCTGGACCTCGTCTGCCAGCGCTACTTCTCCGACGAGAGCCGCGGCGGCGTCCATGGCGG
CCGCCCCGTCGTCCTCGGCGGCGACAACCCGCAGTGCCGGATCCCCGAGGTGCACAAGGACGTGGCGACCTTCAT
GCTCGTCATCAACTTCGTCACGGGCGGCCTCAGTGCCGTCGTCGCGCCCAAGCTGGGCCACCTGTCGGACCGCTA
CGGCCGGCGGCGGCTGCTGGCCCTGGCCTCGTGCGGCGGCCTCCTGGCCGAGCTCATCACCATCCTGGCCGCCAA
GTTCCCCCAGGCCGTCGACTACCGCTGGATGGTGCTGGGGGCCGTCTTCGACGGCATGACCGGCTCCTTCACCGC
CGGCAGCCTGCTCAGCCAGTCGTACACGAGCGACTGCACGCCGCCCTCCAAGCGGGCCGTGTCCATGGGCTACAT
CCAGGCCTGCCTGTTCGTCGGCCTCGCCTTCGGGCCGCTGCTGGCCGGCTACTTCGTCAAGTGGACCGGCAGCCT
CGTGTCCATCTTCTACGTCGCCCTCGGCTGCCACACCTTCTTCGTCCTCTTCGTCGGCCTCGTCATCCCCGAGTC
GCTGTCGGCCAAGAGGCAGGCCGCGGCGCGGGACAAGTGGCAGAAGGAGAAGGAGGCGCGCGCCCTGCACGTCGG
CTCCTGGCTGTCGACGCTGCTCTCCTCGAACCCCCTGGCGCCGCTGCAGATCCTGTGGCCGACGGGGCCGGGGAC
GTCGACGCGGCTGCGTCTCAACCTGGTGGCGCTGGCGACGTGCGACGCCATCATCTTCGGGGCCGCCTTCGCCGT
CGGGCCCGTCATCATGCTGTACGCCGAGTACATGTTCAACTGGGGCAACTTTGAGACGTCTCGCTTCATCTCGGC
CCTGTCCATGGCGCGCGTCGTCGTCCTGATGGGCCTCTTCCCCGCCATCAACTACTTTGGCCGCGTCCGGCCGGC
GGCTCGGCGGCACGCGCGGCTGGGCACGACGCCCGTGGAGCGCAACTTCGGGGCGGACCGGCTCGACGTCTGGAT
CGTCCGGCTCGCGCTGGTCTGGGAGGTGCTGGGATGCCTGGGCTACGCGCTCGGGCGGTCGCAGGAGCTGTTCAT
CCTCTGCGGCATGGTGACGGCGCTCGGCGGACTCGGGAGCGCCACTATCCAGGCCGCGGTGACGAAGCAGGTGCC
TACGGGACGCGTGGGCCAGATCCTCGGTGCCGTCGGCATGATGCACGCGCTGGCCCGGATCGTCGGGCCCGTCGT
CTTCAACGGAATCTACGCCGCCACCGTCGCCACCTTTCCGCAGGCCGTCTTCCTCGCCCTCTGCGGCCTCTTTGT
CGTCGCTCTCGTCGTCAGCCTCGTCGTCAAGCCATACGGTGAGTCCCGCCCGAGCGCGCCCCCGCTTGCCCGAGC
TGCTTCTGACGCGCGCGACAGTCCACTGGGAGGAGACCCACGACGACGAGGGGGAGGAGGAGCCGCTGAACCGGA
CGCAGCAGCTGTTCGACACGACCGCGGACACGCTGCCCGTCGACGAGGGTCAAGTCCGCGTCCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail