Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4613
Gene name
LocationContig_2338:1716..2759
Strand+
Gene length (bp)1043
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 1.7E-30 35 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 3 262 1.0E-35
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 26 262 3.0E-30
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 26 262 4.0E-30
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 1 262 3.0E-29
sp|P38888|MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL1 PE=1 SV=1 17 218 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 3 262 1.0E-35
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 26 262 3.0E-30
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 26 262 4.0E-30
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 1 262 3.0E-29
sp|P38888|MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL1 PE=1 SV=1 17 218 2.0E-28
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 24 262 1.0E-25
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 6 262 7.0E-25
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 6 262 1.0E-24
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 17 262 2.0E-21
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 10 221 2.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0016020 membrane Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005575 cellular_component No
GO:0043167 ion binding No
GO:0004559 alpha-mannosidase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0015923 mannosidase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4613
MWLAALLPACALLPSTAAAMRADRLAQLRQETVDMFYHGYSNYMRHAFPEDEIGLNDALGNYSLTLIDSLSTLAI
LAGGPQDGSYTGPQALRDFQDGIAQFVAHYGDGRPGPSGTGSRATGFDLDSKVQVFETVIRGVGGLLSAHLFAIG
ELPIPGYVPRPAPGFFPRDDPLELAPIPWPGGFRYDGQLLRLALDLAQRLLPAFYTTTGIPYPRVNLRSGIPFYV
NSPLHHRAAAERREPDAGAGREITETCSAGAGSLTLEPPSGPSGRCGGGGARSA*
Coding >Hirsu2|4613
ATGTGGTTGGCTGCCCTGCTGCCGGCGTGCGCCCTGCTGCCGTCCACGGCGGCCGCCATGCGCGCCGACCGCCTG
GCCCAGCTGCGCCAGGAAACCGTCGACATGTTCTACCACGGCTACAGCAACTACATGCGCCACGCGTTCCCCGAA
GATGAGATCGGGCTGAACGACGCGCTCGGCAACTACTCCCTGACGCTCATCGACAGCCTGTCGACGCTCGCCATC
CTGGCCGGCGGGCCCCAGGACGGCTCCTACACCGGCCCGCAGGCCCTCCGCGACTTCCAGGACGGCATCGCCCAG
TTCGTCGCCCACTACGGCGACGGCCGGCCGGGGCCCTCGGGCACCGGCAGCCGCGCCACGGGCTTCGACCTCGAC
AGCAAGGTCCAGGTCTTCGAGACGGTCATCCGCGGCGTCGGCGGCCTGCTGAGCGCCCACCTGTTCGCCATCGGC
GAGCTGCCCATCCCGGGGTACGTGCCGCGGCCGGCGCCCGGCTTCTTCCCCCGCGACGACCCGCTCGAGCTGGCG
CCGATCCCGTGGCCCGGCGGCTTCCGCTACGACGGCCAGCTGCTGAGGCTGGCCCTCGACCTCGCCCAGCGCCTG
CTGCCCGCCTTCTACACGACGACGGGCATCCCCTACCCCCGCGTCAACCTGCGGTCCGGCATCCCCTTCTACGTC
AACTCGCCCCTGCACCACCGGGCCGCGGCCGAGCGTCGCGAGCCCGACGCCGGCGCCGGCCGGGAGATCACCGAG
ACCTGCAGCGCCGGCGCCGGCAGCCTGACGCTCGAGCCGCCAAGCGGGCCTTCTGGGAGGTGTGGCGGCGGCGGA
GCGAGATCGGCCTGA
Transcript >Hirsu2|4613
ATGTGGTTGGCTGCCCTGCTGCCGGCGTGCGCCCTGCTGCCGTCCACGGCGGCCGCCATGCGCGCCGACCGCCTG
GCCCAGCTGCGCCAGGAAACCGTCGACATGTTCTACCACGGCTACAGCAACTACATGCGCCACGCGTTCCCCGAA
GATGAGATCGGGCTGAACGACGCGCTCGGCAACTACTCCCTGACGCTCATCGACAGCCTGTCGACGCTCGCCATC
CTGGCCGGCGGGCCCCAGGACGGCTCCTACACCGGCCCGCAGGCCCTCCGCGACTTCCAGGACGGCATCGCCCAG
TTCGTCGCCCACTACGGCGACGGCCGGCCGGGGCCCTCGGGCACCGGCAGCCGCGCCACGGGCTTCGACCTCGAC
AGCAAGGTCCAGGTCTTCGAGACGGTCATCCGCGGCGTCGGCGGCCTGCTGAGCGCCCACCTGTTCGCCATCGGC
GAGCTGCCCATCCCGGGGTACGTGCCGCGGCCGGCGCCCGGCTTCTTCCCCCGCGACGACCCGCTCGAGCTGGCG
CCGATCCCGTGGCCCGGCGGCTTCCGCTACGACGGCCAGCTGCTGAGGCTGGCCCTCGACCTCGCCCAGCGCCTG
CTGCCCGCCTTCTACACGACGACGGGCATCCCCTACCCCCGCGTCAACCTGCGGTCCGGCATCCCCTTCTACGTC
AACTCGCCCCTGCACCACCGGGCCGCGGCCGAGCGTCGCGAGCCCGACGCCGGCGCCGGCCGGGAGATCACCGAG
ACCTGCAGCGCCGGCGCCGGCAGCCTGACGCTCGAGCCGCCAAGCGGGCCTTCTGGGAGGTGTGGCGGCGGCGGA
GCGAGATCGGCCTGA
Gene >Hirsu2|4613
ATGTGGTTGGCTGCCCTGCTGCCGGCGTGCGCCCTGCTGCCGTCCACGGCGGCCGCCATGCGCGCCGACCGCCTG
GCCCAGCTGCGCCAGGAAACCGTCGACATGTTCTACCACGGCTACAGCAACTACATGCGCCACGCGTTCCCCGAA
GATGAGGTATCTCCCGCCTTGGCCGGCCTCTTTGGCTCCATTCTCTCCCCCATCTTTTCTTGCAGCCGCCTTGCT
GACGCTCAAACTCCCAAACCCCTTCCCCCTTCAGCTGCGACCGCTTACCTGCACGCCCCTGACGAGAGACCGGCA
CGACCCGACGCAGATCGGGCTGAACGACGCGCTCGGCAACTACTCCCTGACGCTCATCGACAGCCTGTCGACGCT
CGCCATCCTGGCCGGCGGGCCCCAGGACGGCTCCTACACCGGCCCGCAGGCCCTCCGCGACTTCCAGGACGGCAT
CGCCCAGTTCGTCGCCCACTACGGCGACGGCCGGCCGGGGCCCTCGGGCACCGGCAGCCGCGCCACGGGCTTCGA
CCTCGACAGCAAGGTCCAGGTCTTCGAGACGGTCATCCGCGGCGTCGGCGGCCTGCTGAGCGCCCACCTGTTCGC
CATCGGCGAGCTGCCCATCCCGGGGTACGTGCCGCGGCCGGCGCCCGGCTTCTTCCCCCGCGACGACCCGCTCGA
GCTGGCGCCGATCCCGTGGCCCGGCGGCTTCCGCTACGACGGCCAGCTGCTGAGGCTGGCCCTCGACCTCGCCCA
GCGCCTGCTGCCCGCCTTCTACACGACGACGGGCATCCCCTACCCCCGCGTCAACCTGCGGTCCGGCATCCCCTT
CTACGTCAACTCGCCCCTGCACCACCGGGCCGCGGCCGAGCGTCGCGAGCCCGACGCCGGCGCCGGCCGGGAGAT
CACCGAGACCTGCAGCGCCGGCGCCGGCAGCCTGACGCTCGAGTTCACCGTCCTCAGCCGCCTGACGGGCGACGC
GCGCTTCGAGCAGGCCGCCAAGCGGGCCTTCTGGGAGGTGTGGCGGCGGCGGAGCGAGATCGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail