Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4612
Gene name
LocationContig_2338:95..878
Strand+
Gene length (bp)783
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04991|FMP42_YEAST Protein FMP42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP42 PE=1 SV=1 1 170 7.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 42 64 22
3 67 89 22
4 94 116 22
5 129 149 20
6 164 186 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4612
MRTPWFLLLLLLTALQMLRMNHFIATVRAQYAYLLASDRDAAAINSFFDAALPVSGVAATPLVAAVLNSFSVAAV
LAILTACIAVNGLLNCLPFLWAGFATVLEFVTLRPFYYSAVSHTATQMFGFETFGLIYGTIICAAGLVNAFQSAL
DSLMYGPLGGNPTPINMALAGAGTVVGAFFAAFVAIKSRRWRESSQQGSLSERLSLIQDDDREYGTSIIQRIQ*
Coding >Hirsu2|4612
ATGCGCACGCCCTGGTTCCTGCTGCTGCTGCTGCTGACGGCGCTGCAGATGCTGCGGATGAACCACTTCATCGCC
ACCGTCCGCGCCCAGTACGCCTACCTGCTGGCCTCGGACCGCGACGCCGCCGCCATCAACAGCTTCTTCGACGCC
GCCCTGCCCGTCAGCGGCGTCGCCGCCACGCCCCTCGTCGCCGCCGTCCTCAACAGCTTCAGCGTCGCCGCCGTG
CTCGCCATCCTCACCGCCTGCATCGCCGTCAACGGCCTGCTCAACTGCCTGCCCTTCCTGTGGGCCGGCTTCGCC
ACCGTCCTCGAGTTCGTCACCCTGCGCCCCTTTTACTACTCGGCCGTCTCACACACGGCCACCCAGATGTTCGGC
TTCGAGACCTTCGGCCTCATCTACGGCACCATCATCTGTGCCGCCGGCCTCGTCAACGCCTTTCAGTCCGCGCTC
GACTCCCTCATGTATGGCCCGCTCGGCGGGAACCCGACCCCGATCAACATGGCCCTGGCCGGCGCCGGCACCGTC
GTCGGCGCCTTCTTCGCCGCCTTCGTCGCCATCAAGAGCCGCCGCTGGCGGGAATCGTCCCAGCAGGGCTCCCTG
AGCGAGCGTCTGAGCCTCATCCAGGACGACGACCGCGAGTACGGCACCTCCATCATCCAGCGCATACAGTGA
Transcript >Hirsu2|4612
ATGCGCACGCCCTGGTTCCTGCTGCTGCTGCTGCTGACGGCGCTGCAGATGCTGCGGATGAACCACTTCATCGCC
ACCGTCCGCGCCCAGTACGCCTACCTGCTGGCCTCGGACCGCGACGCCGCCGCCATCAACAGCTTCTTCGACGCC
GCCCTGCCCGTCAGCGGCGTCGCCGCCACGCCCCTCGTCGCCGCCGTCCTCAACAGCTTCAGCGTCGCCGCCGTG
CTCGCCATCCTCACCGCCTGCATCGCCGTCAACGGCCTGCTCAACTGCCTGCCCTTCCTGTGGGCCGGCTTCGCC
ACCGTCCTCGAGTTCGTCACCCTGCGCCCCTTTTACTACTCGGCCGTCTCACACACGGCCACCCAGATGTTCGGC
TTCGAGACCTTCGGCCTCATCTACGGCACCATCATCTGTGCCGCCGGCCTCGTCAACGCCTTTCAGTCCGCGCTC
GACTCCCTCATGTATGGCCCGCTCGGCGGGAACCCGACCCCGATCAACATGGCCCTGGCCGGCGCCGGCACCGTC
GTCGGCGCCTTCTTCGCCGCCTTCGTCGCCATCAAGAGCCGCCGCTGGCGGGAATCGTCCCAGCAGGGCTCCCTG
AGCGAGCGTCTGAGCCTCATCCAGGACGACGACCGCGAGTACGGCACCTCCATCATCCAGCGCATACAGTGA
Gene >Hirsu2|4612
ATGCGCACGCCCTGGTTCCTGCTGCTGCTGCTGCTGACGGCGCTGCAGATGCTGCGGATGAACCACTTCATCGCC
ACCGTCCGCGCCCAGTACGCCTACCTGCTGGCCTCGGACCGCGACGCCGCCGCCATCAACAGCTTCTTCGACGCC
GCCCTGCCCGTCAGCGGCGTCGCCGCCACGCCCCTCGTCGCCGCCGTCCTCAACAGCTTCAGCGTCGCCGCCGTG
CTCGCCATCCTCACCGCCTGCATCGCCGTCAACGGCCTGCTCAACTGCCTGCCCTTCCTGTGGGCCGGCTTCGCC
ACCGTCCTCGAGTTCGTCACCCTGCGCCCCTTTTACTACTCGGCCGTCTCGTGAGTTCTTCTCTCCTCTTCACCA
AGACGGGAGGAAAAAAAAAAAGTGAAACCGTCCATGGATCGGTATGTTTCTGACACGTTTTGCTGCTTGCGCTCC
CCCGGCCCAAGACACACGGCCACCCAGATGTTCGGCTTCGAGACCTTCGGCCTCATCTACGGCACCATCATCTGT
GCCGCCGGCCTCGTCAACGCCTTTCAGTCCGCGCTCGACTCCCTCATGTATGGCCCGCTCGGCGGGAACCCGACC
CCGATCAACATGGCCCTGGCCGGCGCCGGCACCGTCGTCGGCGCCTTCTTCGCCGCCTTCGTCGCCATCAAGAGC
CGCCGCTGGCGGGAATCGTCCCAGCAGGGCTCCCTGAGCGAGCGTCTGAGCCTCATCCAGGACGACGACCGCGAG
TACGGCACCTCCATCATCCAGCGCATACAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail