Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4610
Gene name
LocationContig_2336:142..2190
Strand-
Gene length (bp)2048
Transcript length (bp)1974
Coding sequence length (bp)1974
Protein length (aa) 658

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 4.0E-43 1 239
PF03764 EFG_IV Elongation factor G, domain IV 5.8E-32 435 553
PF14492 EFG_II Elongation Factor G, domain II 1.2E-30 360 434
PF00679 EFG_C Elongation factor G C-terminus 3.7E-23 557 642
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 2.7E-13 281 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SH14|EFGM_NEUCR Elongation factor G, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mef1 PE=3 SV=2 1 657 0.0E+00
sp|Q2HEK0|EFGM_CHAGB Elongation factor G, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MEF1 PE=3 SV=1 1 657 0.0E+00
sp|B2WBM8|EFGM_PYRTR Elongation factor G, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mef1 PE=3 SV=1 1 654 0.0E+00
sp|B8MJJ5|EFGM_TALSN Elongation factor G, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|A7EVV9|EFGM_SCLS1 Elongation factor G, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mef1 PE=3 SV=1 1 648 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SH14|EFGM_NEUCR Elongation factor G, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mef1 PE=3 SV=2 1 657 0.0E+00
sp|Q2HEK0|EFGM_CHAGB Elongation factor G, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MEF1 PE=3 SV=1 1 657 0.0E+00
sp|B2WBM8|EFGM_PYRTR Elongation factor G, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mef1 PE=3 SV=1 1 654 0.0E+00
sp|B8MJJ5|EFGM_TALSN Elongation factor G, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|A7EVV9|EFGM_SCLS1 Elongation factor G, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mef1 PE=3 SV=1 1 648 0.0E+00
sp|A6RLH0|EFGM_BOTFB Elongation factor G, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=mef1 PE=3 SV=1 1 648 0.0E+00
sp|B6QHL4|EFGM_TALMQ Elongation factor G, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|Q1DLM0|EFGM_COCIM Elongation factor G, mitochondrial OS=Coccidioides immitis (strain RS) GN=MEF1 PE=3 SV=1 1 657 0.0E+00
sp|Q5B6J8|EFGM_EMENI Elongation factor G, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|A1CXG4|EFGM_NEOFI Elongation factor G, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|Q4WP57|EFGM_ASPFU Elongation factor G, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mef1 PE=3 SV=2 1 647 0.0E+00
sp|B0Y604|EFGM_ASPFC Elongation factor G, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|A1CHC3|EFGM_ASPCL Elongation factor G, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|A2QI77|EFGM_ASPNC Elongation factor G, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef1 PE=3 SV=1 1 648 0.0E+00
sp|Q0CLP3|EFGM_ASPTN Elongation factor G, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mef1 PE=3 SV=1 1 648 0.0E+00
sp|B6H460|EFGM_PENRW Elongation factor G, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|Q2UGQ2|EFGM_ASPOR Elongation factor G, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|B8N9M2|EFGM_ASPFN Elongation factor G, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef1 PE=3 SV=1 1 647 0.0E+00
sp|Q6CRY5|EFGM_KLULA Elongation factor G, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|Q6FUQ6|EFGM_CANGA Elongation factor G, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEF1 PE=3 SV=1 1 648 0.0E+00
sp|Q75CZ5|EFGM_ASHGO Elongation factor G, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEF1 PE=3 SV=2 1 648 0.0E+00
sp|A7A0X4|EFGM_YEAS7 Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|B5VN01|EFGM_YEAS6 Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|B3LT39|EFGM_YEAS1 Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|P25039|EFGM_YEAST Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF1 PE=1 SV=2 1 654 0.0E+00
sp|A7TFN8|EFGM_VANPO Elongation factor G, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MEF1 PE=3 SV=1 1 647 0.0E+00
sp|Q5AL45|EFGM_CANAL Elongation factor G, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|B9W9T4|EFGM_CANDC Elongation factor G, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|Q6C9Y6|EFGM_YARLI Elongation factor G, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|A5DK38|EFGM_PICGU Elongation factor G, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MEF1 PE=3 SV=2 1 648 0.0E+00
sp|Q6BPD3|EFGM_DEBHA Elongation factor G, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|Q9USZ1|EFGM_SCHPO Elongation factor G, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mef1 PE=3 SV=2 1 650 0.0E+00
sp|A3GHT9|EFGM_PICST Elongation factor G, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MEF1 PE=3 SV=2 1 655 0.0E+00
sp|A8P1W0|EFGM_COPC7 Elongation factor G, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|B6K286|EFGM_SCHJY Elongation factor G, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mef1 PE=3 SV=1 1 650 0.0E+00
sp|B0DSK4|EFGM_LACBS Elongation factor G, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|Q4P257|EFGM_USTMA Elongation factor G, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MEF1 PE=3 SV=1 1 655 0.0E+00
sp|A8PXR7|EFGM_MALGO Elongation factor G, mitochondrial OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|P0CN32|EFGM_CRYNJ Elongation factor G, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|P0CN33|EFGM_CRYNB Elongation factor G, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MEF1 PE=3 SV=1 1 654 0.0E+00
sp|Q9FE64|EFGM_ORYSJ Elongation factor G, mitochondrial OS=Oryza sativa subsp. japonica GN=Os03g0565500 PE=2 SV=2 1 649 0.0E+00
sp|Q9C641|EFGM1_ARATH Elongation factor G-1, mitochondrial OS=Arabidopsis thaliana GN=MEFG1 PE=2 SV=1 1 649 0.0E+00
sp|F4IW10|EFGM2_ARATH Elongation factor G-2, mitochondrial OS=Arabidopsis thaliana GN=MEFG2 PE=2 SV=1 1 649 0.0E+00
sp|Q1D9P5|EFG1_MYXXD Elongation factor G 1 OS=Myxococcus xanthus (strain DK 1622) GN=fusA1 PE=3 SV=1 1 655 0.0E+00
sp|Q55E94|EFGM_DICDI Elongation factor G, mitochondrial OS=Dictyostelium discoideum GN=gfm1 PE=3 SV=1 1 648 0.0E+00
sp|A5PKR8|EFGM_XENLA Elongation factor G, mitochondrial OS=Xenopus laevis GN=gfm1 PE=2 SV=1 1 657 0.0E+00
sp|A7RR04|EFGM_NEMVE Elongation factor G, mitochondrial OS=Nematostella vectensis GN=v1g236547 PE=3 SV=1 1 650 0.0E+00
sp|Q73NV3|EFG2_TREDE Elongation factor G 2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fusA2 PE=3 SV=1 1 650 0.0E+00
sp|Q8K0D5|EFGM_MOUSE Elongation factor G, mitochondrial OS=Mus musculus GN=Gfm1 PE=1 SV=1 1 647 0.0E+00
sp|B0WGM1|EFGM_CULQU Elongation factor G, mitochondrial OS=Culex quinquefasciatus GN=CPIJ005834 PE=3 SV=1 1 649 0.0E+00
sp|Q7Q1K8|EFGM_ANOGA Elongation factor G, mitochondrial OS=Anopheles gambiae GN=AGAP009737 PE=3 SV=4 1 649 0.0E+00
sp|Q07803|EFGM_RAT Elongation factor G, mitochondrial OS=Rattus norvegicus GN=Gfm1 PE=1 SV=2 1 647 0.0E+00
sp|Q5R9V1|EFGM_PONAB Elongation factor G, mitochondrial OS=Pongo abelii GN=GFM1 PE=2 SV=1 1 647 0.0E+00
sp|Q96RP9|EFGM_HUMAN Elongation factor G, mitochondrial OS=Homo sapiens GN=GFM1 PE=1 SV=2 1 647 0.0E+00
sp|Q04VH3|EFG_LEPBJ Elongation factor G OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=fusA PE=3 SV=1 1 649 0.0E+00
sp|Q04Y01|EFG_LEPBL Elongation factor G OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=fusA PE=3 SV=1 1 649 0.0E+00
sp|Q16S14|EFGM_AEDAE Elongation factor G, mitochondrial OS=Aedes aegypti GN=AAEL010742 PE=3 SV=1 1 648 0.0E+00
sp|Q6MP77|EFG2_BDEBA Elongation factor G 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=fusA2 PE=3 SV=1 1 650 0.0E+00
sp|Q8F983|EFG_LEPIN Elongation factor G OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=fusA PE=3 SV=1 1 649 0.0E+00
sp|Q72VM5|EFG_LEPIC Elongation factor G OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=fusA PE=3 SV=1 1 649 0.0E+00
sp|B4MZW9|EFGM_DROWI Elongation factor G, mitochondrial OS=Drosophila willistoni GN=ico PE=3 SV=1 1 648 0.0E+00
sp|B4KKD5|EFGM_DROMO Elongation factor G, mitochondrial OS=Drosophila mojavensis GN=ico PE=3 SV=1 1 648 0.0E+00
sp|O83748|EFG1_TREPA Elongation factor G 1 OS=Treponema pallidum (strain Nichols) GN=fusA PE=3 SV=1 1 655 0.0E+00
sp|B4LS49|EFGM_DROVI Elongation factor G, mitochondrial OS=Drosophila virilis GN=ico PE=3 SV=1 1 648 0.0E+00
sp|B4NZM7|EFGM_DROYA Elongation factor G, mitochondrial OS=Drosophila yakuba GN=ico PE=3 SV=1 1 648 0.0E+00
sp|B4Q5D5|EFGM_DROSI Elongation factor G, mitochondrial OS=Drosophila simulans GN=ico PE=3 SV=1 1 648 0.0E+00
sp|B4HY41|EFGM_DROSE Elongation factor G, mitochondrial OS=Drosophila sechellia GN=ico PE=3 SV=1 1 648 0.0E+00
sp|Q9VM33|EFGM_DROME Elongation factor G, mitochondrial OS=Drosophila melanogaster GN=ico PE=2 SV=2 1 648 0.0E+00
sp|B3N6A5|EFGM_DROER Elongation factor G, mitochondrial OS=Drosophila erecta GN=ico PE=3 SV=1 1 648 0.0E+00
sp|B4JQM7|EFGM_DROGR Elongation factor G, mitochondrial OS=Drosophila grimshawi GN=ico PE=3 SV=1 1 648 0.0E+00
sp|Q08BB1|EFGM_DANRE Elongation factor G, mitochondrial OS=Danio rerio GN=gfm1 PE=2 SV=1 1 657 0.0E+00
sp|Q2LTB9|EFG1_SYNAS Elongation factor G 1 OS=Syntrophus aciditrophicus (strain SB) GN=fusA1 PE=3 SV=1 1 643 0.0E+00
sp|B3MK91|EFGM_DROAN Elongation factor G, mitochondrial OS=Drosophila ananassae GN=ico PE=3 SV=1 1 648 0.0E+00
sp|Q29N77|EFGM_DROPS Elongation factor G, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=ico PE=3 SV=1 1 648 0.0E+00
sp|O30913|EFG1_BORBU Elongation factor G 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fusA PE=3 SV=2 1 653 0.0E+00
sp|Q6ASC7|EFG1_DESPS Elongation factor G 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fusA1 PE=3 SV=1 1 650 0.0E+00
sp|Q0SMX0|EFG1_BORAP Elongation factor G 1 OS=Borrelia afzelii (strain PKo) GN=fusA1 PE=3 SV=1 1 653 0.0E+00
sp|Q660Y4|EFG1_BORBP Elongation factor G 1 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=fusA1 PE=3 SV=1 1 653 0.0E+00
sp|Q2IK81|EFG2_ANADE Elongation factor G 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=fusA2 PE=3 SV=1 1 652 0.0E+00
sp|Q9XV52|EFGM_CAEEL Elongation factor G, mitochondrial OS=Caenorhabditis elegans GN=gfm-1 PE=3 SV=1 1 648 0.0E+00
sp|A8WTI8|EFGM_CAEBR Elongation factor G, mitochondrial OS=Caenorhabditis briggsae GN=gfm-1 PE=3 SV=2 1 648 0.0E+00
sp|Q7URV2|EFG_RHOBA Elongation factor G OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|B9L7K0|EFG_NAUPA Elongation factor G OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=fusA PE=3 SV=1 1 649 0.0E+00
sp|B9KFH1|EFG_CAMLR Elongation factor G OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|A7I3T6|EFG_CAMHC Elongation factor G OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|A6Q1M7|EFG_NITSB Elongation factor G OS=Nitratiruptor sp. (strain SB155-2) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|B1ZLK1|EFG_METPB Elongation factor G OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=fusA PE=3 SV=1 1 647 0.0E+00
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 1 650 0.0E+00
sp|A7H4P5|EFG_CAMJD Elongation factor G OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|Q88XY8|EFG_LACPL Elongation factor G OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|Q5HVX6|EFG_CAMJR Elongation factor G OS=Campylobacter jejuni (strain RM1221) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|Q9PI16|EFG_CAMJE Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|A8FKR7|EFG_CAMJ8 Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|A1VYJ8|EFG_CAMJJ Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=fusA PE=3 SV=1 1 646 0.0E+00
sp|A0RQI0|EFG_CAMFF Elongation factor G OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=fusA PE=3 SV=1 1 646 1.0E-180
sp|A6LLL0|EFG_THEM4 Elongation factor G OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=fusA PE=3 SV=1 1 646 2.0E-180
sp|P74228|EFG2_SYNY3 Elongation factor G 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusB PE=3 SV=1 2 646 4.0E-179
sp|Q03PV4|EFG_LACBA Elongation factor G OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fusA PE=3 SV=1 1 646 5.0E-179
sp|Q38UQ9|EFG_LACSS Elongation factor G OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fusA PE=3 SV=1 1 646 6.0E-179
sp|A6X0B5|EFG_OCHA4 Elongation factor G OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=fusA PE=3 SV=1 1 647 9.0E-179
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 1 644 2.0E-178
sp|B8IS82|EFG_METNO Elongation factor G OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fusA PE=3 SV=1 1 647 4.0E-178
sp|O66428|EFG_AQUAE Elongation factor G OS=Aquifex aeolicus (strain VF5) GN=fusA PE=3 SV=1 1 649 6.0E-178
sp|B1HMZ1|EFG_LYSSC Elongation factor G OS=Lysinibacillus sphaericus (strain C3-41) GN=fusA PE=3 SV=1 1 650 6.0E-178
sp|Q5L400|EFG_GEOKA Elongation factor G OS=Geobacillus kaustophilus (strain HTA426) GN=fusA PE=3 SV=1 1 650 6.0E-178
sp|A9W4P8|EFG_METEP Elongation factor G OS=Methylobacterium extorquens (strain PA1) GN=fusA PE=3 SV=1 1 647 2.0E-177
sp|B7L0Q8|EFG_METC4 Elongation factor G OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=fusA PE=3 SV=1 1 647 2.0E-177
sp|B7IHU3|EFG_THEAB Elongation factor G OS=Thermosipho africanus (strain TCF52B) GN=fusA PE=3 SV=1 1 646 2.0E-177
sp|P56002|EFG_HELPY Elongation factor G OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fusA PE=3 SV=2 1 646 3.0E-177
sp|Q17VN9|EFG_HELAH Elongation factor G OS=Helicobacter acinonychis (strain Sheeba) GN=fusA PE=3 SV=1 1 646 3.0E-177
sp|Q9ZK24|EFG_HELPJ Elongation factor G OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fusA PE=3 SV=3 1 646 3.0E-177
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 1 650 3.0E-177
sp|A7GZJ4|EFG_CAMC5 Elongation factor G OS=Campylobacter curvus (strain 525.92) GN=fusA PE=3 SV=1 1 646 4.0E-177
sp|Q7MA53|EFG_WOLSU Elongation factor G OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=fusA PE=3 SV=1 1 646 4.0E-177
sp|Q1CS71|EFG_HELPH Elongation factor G OS=Helicobacter pylori (strain HPAG1) GN=fusA PE=3 SV=1 1 646 4.0E-177
sp|B3WAM2|EFG_LACCB Elongation factor G OS=Lactobacillus casei (strain BL23) GN=fusA PE=3 SV=1 1 646 5.0E-177
sp|B2UUV6|EFG_HELPS Elongation factor G OS=Helicobacter pylori (strain Shi470) GN=fusA PE=3 SV=1 1 646 6.0E-177
sp|A8YXK3|EFG_LACH4 Elongation factor G OS=Lactobacillus helveticus (strain DPC 4571) GN=fusA PE=3 SV=1 1 652 6.0E-177
sp|B1LWS3|EFG_METRJ Elongation factor G OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=fusA PE=3 SV=1 1 647 8.0E-177
sp|Q118Z3|EFG1_TRIEI Elongation factor G 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA1 PE=3 SV=1 2 646 8.0E-177
sp|B6JN34|EFG_HELP2 Elongation factor G OS=Helicobacter pylori (strain P12) GN=fusA PE=3 SV=1 1 646 9.0E-177
sp|Q034X8|EFG_LACC3 Elongation factor G OS=Lactobacillus casei (strain ATCC 334) GN=fusA PE=3 SV=1 1 646 1.0E-176
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 1 652 1.0E-176
sp|Q2RFP4|EFG_MOOTA Elongation factor G OS=Moorella thermoacetica (strain ATCC 39073) GN=fusA PE=3 SV=1 1 649 1.0E-176
sp|B9MQH0|EFG_CALBD Elongation factor G OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=fusA PE=3 SV=1 1 644 1.0E-176
sp|B1GZ80|EFG_UNCTG Elongation factor G OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=fusA PE=3 SV=1 1 646 1.0E-176
sp|Q8UE15|EFG_AGRFC Elongation factor G OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fusA PE=3 SV=1 1 650 1.0E-176
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 1 644 2.0E-176
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 2 646 2.0E-176
sp|A8Z6I6|EFG_CAMC1 Elongation factor G OS=Campylobacter concisus (strain 13826) GN=fusA PE=3 SV=1 1 646 2.0E-176
sp|B5ZYT2|EFG_RHILW Elongation factor G OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=fusA PE=3 SV=1 1 650 2.0E-176
sp|B5Z8J0|EFG_HELPG Elongation factor G OS=Helicobacter pylori (strain G27) GN=fusA PE=3 SV=1 1 646 3.0E-176
sp|A4XI36|EFG_CALS8 Elongation factor G OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fusA PE=3 SV=1 1 644 3.0E-176
sp|Q1MIE4|EFG_RHIL3 Elongation factor G OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=fusA PE=3 SV=1 1 650 3.0E-176
sp|B9JDS6|EFG_AGRRK Elongation factor G OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=fusA PE=3 SV=1 1 650 4.0E-176
sp|Q1GP96|EFG_SPHAL Elongation factor G OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=fusA PE=3 SV=1 1 646 7.0E-176
sp|A4XBP9|EFG_SALTO Elongation factor G OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=fusA PE=3 SV=1 1 650 1.0E-175
sp|A6U856|EFG_SINMW Elongation factor G OS=Sinorhizobium medicae (strain WSM419) GN=fusA PE=3 SV=1 1 650 1.0E-175
sp|C5D3R4|EFG_GEOSW Elongation factor G OS=Geobacillus sp. (strain WCH70) GN=fusA PE=3 SV=1 1 650 1.0E-175
sp|A8M532|EFG_SALAI Elongation factor G OS=Salinispora arenicola (strain CNS-205) GN=fusA PE=3 SV=1 1 650 1.0E-175
sp|A7GK17|EFG_BACCN Elongation factor G OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=fusA PE=3 SV=1 1 650 2.0E-175
sp|Q8YHP3|EFG_BRUME Elongation factor G OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|Q8G075|EFG_BRUSU Elongation factor G OS=Brucella suis biovar 1 (strain 1330) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|A9M5Q3|EFG_BRUC2 Elongation factor G OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|A7HWQ8|EFG_PARL1 Elongation factor G OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fusA PE=3 SV=1 1 646 2.0E-175
sp|B0UHX2|EFG_METS4 Elongation factor G OS=Methylobacterium sp. (strain 4-46) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|Q57CQ5|EFG_BRUAB Elongation factor G OS=Brucella abortus biovar 1 (strain 9-941) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|Q2YM00|EFG_BRUA2 Elongation factor G OS=Brucella abortus (strain 2308) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|B2S682|EFG_BRUA1 Elongation factor G OS=Brucella abortus (strain S19) GN=fusA PE=3 SV=1 1 647 2.0E-175
sp|C4KZQ0|EFG_EXISA Elongation factor G OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=fusA PE=3 SV=1 1 646 2.0E-175
sp|Q03IS1|EFG_STRTD Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=fusA PE=3 SV=1 1 650 3.0E-175
sp|Q5M2M6|EFG_STRT2 Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fusA PE=3 SV=1 1 650 3.0E-175
sp|Q5LY21|EFG_STRT1 Elongation factor G OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fusA PE=3 SV=1 1 650 3.0E-175
sp|B7GJ64|EFG_ANOFW Elongation factor G OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=fusA PE=3 SV=1 1 650 3.0E-175
sp|Q8KQB3|EFG_BARHE Elongation factor G OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fusA PE=3 SV=1 1 647 3.0E-175
sp|Q0RRS4|EFG_FRAAA Elongation factor G OS=Frankia alni (strain ACN14a) GN=fusA PE=3 SV=1 1 650 3.0E-175
sp|P13550|EFG_ARTPT Elongation factor G OS=Arthrospira platensis GN=fusA PE=3 SV=1 2 646 3.0E-175
sp|A8LC59|EFG_FRASN Elongation factor G OS=Frankia sp. (strain EAN1pec) GN=fusA PE=3 SV=1 1 650 4.0E-175
sp|Q8YP62|EFG_NOSS1 Elongation factor G OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fusA PE=3 SV=1 2 646 4.0E-175
sp|A5VR09|EFG_BRUO2 Elongation factor G OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=fusA PE=3 SV=1 1 647 5.0E-175
sp|B0CH35|EFG_BRUSI Elongation factor G OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=fusA PE=3 SV=1 1 647 5.0E-175
sp|Q2K9L9|EFG_RHIEC Elongation factor G OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fusA PE=3 SV=1 1 650 7.0E-175
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 1 650 7.0E-175
sp|B3PWR8|EFG_RHIE6 Elongation factor G OS=Rhizobium etli (strain CIAT 652) GN=fusA PE=3 SV=1 1 650 8.0E-175
sp|A0ALY9|EFG_LISW6 Elongation factor G OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=fusA PE=3 SV=1 1 644 9.0E-175
sp|C0RJK4|EFG_BRUMB Elongation factor G OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=fusA PE=3 SV=1 1 647 9.0E-175
sp|B9JVN4|EFG_AGRVS Elongation factor G OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=fusA PE=3 SV=1 1 650 1.0E-174
sp|Q250N5|EFG_DESHY Elongation factor G OS=Desulfitobacterium hafniense (strain Y51) GN=fusA PE=3 SV=1 1 646 1.0E-174
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 1 644 1.0E-174
sp|Q0ANP7|EFG_MARMM Elongation factor G OS=Maricaulis maris (strain MCS10) GN=fusA PE=3 SV=1 1 646 2.0E-174
sp|B8G1W3|EFG_DESHD Elongation factor G OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=fusA PE=3 SV=1 1 646 2.0E-174
sp|Q8Y421|EFG_LISMO Elongation factor G OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fusA PE=3 SV=1 1 644 2.0E-174
sp|B8DAY6|EFG_LISMH Elongation factor G OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=fusA PE=3 SV=1 1 644 2.0E-174
sp|Q71WB8|EFG_LISMF Elongation factor G OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fusA PE=3 SV=1 1 644 2.0E-174
sp|C1KZK7|EFG_LISMC Elongation factor G OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=fusA PE=3 SV=1 1 644 2.0E-174
sp|B8D0C1|EFG_HALOH Elongation factor G OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fusA PE=3 SV=1 1 646 2.0E-174
sp|C3MAX7|EFG_RHISN Elongation factor G OS=Rhizobium sp. (strain NGR234) GN=fusA PE=3 SV=1 1 650 2.0E-174
sp|Q1WVA0|EFG_LACS1 Elongation factor G OS=Lactobacillus salivarius (strain UCC118) GN=fusA PE=3 SV=1 1 646 2.0E-174
sp|A9IW31|EFG_BART1 Elongation factor G OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fusA PE=3 SV=1 1 647 3.0E-174
sp|Q2JFH9|EFG_FRASC Elongation factor G OS=Frankia sp. (strain CcI3) GN=fusA PE=3 SV=1 1 650 3.0E-174
sp|A4IJI6|EFG_GEOTN Elongation factor G OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fusA PE=3 SV=1 1 650 4.0E-174
sp|Q3MDM4|EFG_ANAVT Elongation factor G OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fusA PE=3 SV=1 2 646 4.0E-174
sp|Q6FZB9|EFG_BARQU Elongation factor G OS=Bartonella quintana (strain Toulouse) GN=fusA PE=3 SV=1 1 647 5.0E-174
sp|Q927I5|EFG_LISIN Elongation factor G OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fusA PE=3 SV=1 1 644 6.0E-174
sp|P46211|EFG_AQUPY Elongation factor G OS=Aquifex pyrophilus GN=fusA PE=3 SV=2 1 649 7.0E-174
sp|A9VP74|EFG_BACWK Elongation factor G OS=Bacillus weihenstephanensis (strain KBAB4) GN=fusA PE=3 SV=1 1 650 8.0E-174
sp|A8F981|EFG_BACP2 Elongation factor G OS=Bacillus pumilus (strain SAFR-032) GN=fusA PE=3 SV=1 1 650 9.0E-174
sp|Q65PB0|EFG_BACLD Elongation factor G OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fusA PE=3 SV=1 1 650 9.0E-174
sp|Q748Y8|EFG2_GEOSL Elongation factor G 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=fusA2 PE=3 SV=1 1 649 1.0E-173
sp|C0QQM0|EFG_PERMH Elongation factor G OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=fusA PE=3 SV=1 1 650 1.0E-173
sp|B2V7L6|EFG_SULSY Elongation factor G OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fusA PE=3 SV=1 1 646 1.0E-173
sp|Q8DVV4|EFG_STRMU Elongation factor G OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fusA PE=3 SV=1 1 650 1.0E-173
sp|Q63H93|EFG_BACCZ Elongation factor G OS=Bacillus cereus (strain ZK / E33L) GN=fusA PE=3 SV=1 1 650 1.0E-173
sp|P13551|EFG_THETH Elongation factor G OS=Thermus thermophilus GN=fusA PE=1 SV=1 1 644 2.0E-173
sp|Q5SHN5|EFG_THET8 Elongation factor G OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=fusA PE=1 SV=1 1 644 2.0E-173
sp|B9IZJ1|EFG_BACCQ Elongation factor G OS=Bacillus cereus (strain Q1) GN=fusA PE=3 SV=1 1 650 2.0E-173
sp|B7HQU1|EFG_BACC7 Elongation factor G OS=Bacillus cereus (strain AH187) GN=fusA PE=3 SV=1 1 650 2.0E-173
sp|Q211E5|EFG_RHOPB Elongation factor G OS=Rhodopseudomonas palustris (strain BisB18) GN=fusA PE=3 SV=1 1 647 2.0E-173
sp|Q72I01|EFG_THET2 Elongation factor G OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fusA PE=1 SV=1 1 644 3.0E-173
sp|Q6HPR1|EFG_BACHK Elongation factor G OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|C1ET36|EFG_BACC3 Elongation factor G OS=Bacillus cereus (strain 03BB102) GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|Q81VT3|EFG_BACAN Elongation factor G OS=Bacillus anthracis GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|C3P9Q2|EFG_BACAA Elongation factor G OS=Bacillus anthracis (strain A0248) GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|Q814C5|EFG_BACCR Elongation factor G OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|B7HJ45|EFG_BACC4 Elongation factor G OS=Bacillus cereus (strain B4264) GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|B4U741|EFG_HYDS0 Elongation factor G OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=fusA PE=3 SV=1 1 646 3.0E-173
sp|Q92QH2|EFG_RHIME Elongation factor G OS=Rhizobium meliloti (strain 1021) GN=fusA PE=3 SV=1 1 650 3.0E-173
sp|B5EFP7|EFG_GEOBB Elongation factor G OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fusA PE=3 SV=1 1 649 4.0E-173
sp|Q73F99|EFG_BACC1 Elongation factor G OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=fusA PE=3 SV=1 1 650 6.0E-173
sp|Q1IX68|EFG_DEIGD Elongation factor G OS=Deinococcus geothermalis (strain DSM 11300) GN=fusA PE=3 SV=1 1 646 7.0E-173
sp|B9K883|EFG_THENN Elongation factor G OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fusA PE=3 SV=1 2 644 7.0E-173
sp|Q9RXK5|EFG_DEIRA Elongation factor G OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fusA PE=3 SV=1 1 646 7.0E-173
sp|A5FV42|EFG_ACICJ Elongation factor G OS=Acidiphilium cryptum (strain JF-5) GN=fusA PE=3 SV=1 2 646 7.0E-173
sp|B7IT16|EFG_BACC2 Elongation factor G OS=Bacillus cereus (strain G9842) GN=fusA PE=3 SV=1 1 650 9.0E-173
sp|A5IM80|EFG_THEP1 Elongation factor G OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fusA PE=3 SV=1 2 644 1.0E-172
sp|Q8DI43|EFG_THEEB Elongation factor G OS=Thermosynechococcus elongatus (strain BP-1) GN=fusA PE=3 SV=1 2 646 1.0E-172
sp|Q605A9|EFG2_METCA Elongation factor G 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=fusA2 PE=3 SV=1 1 646 1.0E-172
sp|Q7VJ85|EFG_HELHP Elongation factor G OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=fusA PE=3 SV=1 1 646 1.0E-172
sp|C3LJ79|EFG_BACAC Elongation factor G OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fusA PE=3 SV=1 1 650 2.0E-172
sp|B2GDX1|EFG_LACF3 Elongation factor G OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=fusA PE=3 SV=1 1 646 2.0E-172
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 1 646 2.0E-172
sp|Q7NEF2|EFG_GLOVI Elongation factor G OS=Gloeobacter violaceus (strain PCC 7421) GN=fusA PE=3 SV=1 2 646 2.0E-172
sp|Q9Z9L7|EFG_BACHD Elongation factor G OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fusA PE=3 SV=2 1 650 2.0E-172
sp|B7JKB6|EFG_BACC0 Elongation factor G OS=Bacillus cereus (strain AH820) GN=fusA PE=3 SV=1 1 650 3.0E-172
sp|B1LBP3|EFG_THESQ Elongation factor G OS=Thermotoga sp. (strain RQ2) GN=fusA PE=3 SV=1 2 644 3.0E-172
sp|P70782|EFG_RHIRD Elongation factor G OS=Rhizobium radiobacter GN=fusA PE=3 SV=1 1 650 4.0E-172
sp|A8IAT3|EFG_AZOC5 Elongation factor G OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fusA PE=3 SV=1 1 647 4.0E-172
sp|Q11HP9|EFG_CHESB Elongation factor G OS=Chelativorans sp. (strain BNC1) GN=fusA PE=3 SV=1 1 647 5.0E-172
sp|B5ELX6|EFG_ACIF5 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fusA PE=3 SV=1 1 648 8.0E-172
sp|B7J464|EFG_ACIF2 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=fusA PE=3 SV=1 1 648 8.0E-172
sp|Q2GD82|EFG_NEOSM Elongation factor G OS=Neorickettsia sennetsu (strain Miyayama) GN=fusA PE=3 SV=1 1 649 1.0E-171
sp|A8F0P0|EFG_RICM5 Elongation factor G OS=Rickettsia massiliae (strain Mtu5) GN=fusA PE=3 SV=2 1 646 1.0E-171
sp|A9BHA8|EFG_PETMO Elongation factor G OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=fusA PE=3 SV=1 2 646 1.0E-171
sp|Q7NAV3|EFG_MYCGA Elongation factor G OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=fusA PE=3 SV=2 1 644 1.0E-171
sp|A7IFX8|EFG_XANP2 Elongation factor G OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=fusA PE=3 SV=1 1 647 1.0E-171
sp|Q1Q8P1|EFG_PSYCK Elongation factor G OS=Psychrobacter cryohalolentis (strain K5) GN=fusA PE=3 SV=1 1 647 1.0E-171
sp|P38525|EFG_THEMA Elongation factor G OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fusA PE=3 SV=2 2 644 2.0E-171
sp|Q8E3E7|EFG_STRA3 Elongation factor G OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fusA PE=3 SV=1 1 650 2.0E-171
sp|A7Z0N4|EFG_BACMF Elongation factor G OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=fusA PE=3 SV=1 1 650 2.0E-171
sp|A3PEZ8|EFG_PROM0 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9301) GN=fusA PE=3 SV=1 2 649 2.0E-171
sp|Q2JUX5|EFG_SYNJA Elongation factor G OS=Synechococcus sp. (strain JA-3-3Ab) GN=fusA PE=3 SV=1 2 646 2.0E-171
sp|Q47LJ0|EFG_THEFY Elongation factor G OS=Thermobifida fusca (strain YX) GN=fusA PE=3 SV=1 1 650 3.0E-171
sp|Q4FQG5|EFG_PSYA2 Elongation factor G OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fusA PE=3 SV=1 1 647 3.0E-171
sp|Q39Y09|EFG1_GEOMG Elongation factor G 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fusA1 PE=3 SV=1 1 649 4.0E-171
sp|A8AUR6|EFG_STRGC Elongation factor G OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=fusA PE=3 SV=1 1 650 4.0E-171
sp|Q8DXS7|EFG_STRA5 Elongation factor G OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fusA PE=3 SV=1 1 650 5.0E-171
sp|Q3JZB5|EFG_STRA1 Elongation factor G OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fusA PE=3 SV=1 1 650 5.0E-171
sp|Q3SLQ2|EFG_THIDA Elongation factor G OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fusA PE=3 SV=1 1 646 6.0E-171
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 1 646 6.0E-171
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 2 649 6.0E-171
sp|B3E7T2|EFG_GEOLS Elongation factor G OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fusA PE=3 SV=1 1 649 7.0E-171
sp|A8G709|EFG_PROM2 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9215) GN=fusA PE=3 SV=1 2 649 7.0E-171
sp|C1CXH0|EFG_DEIDV Elongation factor G OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=fusA PE=3 SV=1 1 646 1.0E-170
sp|A3CQM2|EFG_STRSV Elongation factor G OS=Streptococcus sanguinis (strain SK36) GN=fusA PE=3 SV=1 1 650 1.0E-170
sp|A9KRZ3|EFG_CLOPH Elongation factor G OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=fusA PE=3 SV=1 1 645 1.0E-170
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 1 647 1.0E-170
sp|A4VSN3|EFG_STRSY Elongation factor G OS=Streptococcus suis (strain 05ZYH33) GN=fusA PE=3 SV=1 1 646 1.0E-170
sp|A4VYX6|EFG_STRS2 Elongation factor G OS=Streptococcus suis (strain 98HAH33) GN=fusA PE=3 SV=1 1 646 1.0E-170
sp|A5GIP1|EFG_SYNPW Elongation factor G OS=Synechococcus sp. (strain WH7803) GN=fusA PE=3 SV=1 2 649 1.0E-170
sp|P80868|EFG_BACSU Elongation factor G OS=Bacillus subtilis (strain 168) GN=fusA PE=1 SV=3 1 650 2.0E-170
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 1 646 2.0E-170
sp|B1YGU7|EFG_EXIS2 Elongation factor G OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=fusA PE=3 SV=1 1 646 2.0E-170
sp|Q98N59|EFG_RHILO Elongation factor G OS=Rhizobium loti (strain MAFF303099) GN=fusA PE=3 SV=1 1 647 2.0E-170
sp|Q5FUP6|EFG_GLUOX Elongation factor G OS=Gluconobacter oxydans (strain 621H) GN=fusA PE=3 SV=1 2 646 2.0E-170
sp|A8GQV7|EFG_RICRS Elongation factor G OS=Rickettsia rickettsii (strain Sheila Smith) GN=fusA PE=3 SV=1 1 646 2.0E-170
sp|B0BWA2|EFG_RICRO Elongation factor G OS=Rickettsia rickettsii (strain Iowa) GN=fusA PE=3 SV=1 1 646 2.0E-170
sp|B5ZC32|EFG_UREU1 Elongation factor G OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=fusA PE=3 SV=1 1 645 3.0E-170
sp|Q2G8Y3|EFG_NOVAD Elongation factor G OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=fusA PE=3 SV=1 1 646 3.0E-170
sp|A2BT84|EFG_PROMS Elongation factor G OS=Prochlorococcus marinus (strain AS9601) GN=fusA PE=3 SV=1 2 649 3.0E-170
sp|Q2JMX8|EFG_SYNJB Elongation factor G OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fusA PE=3 SV=1 2 646 3.0E-170
sp|Q1H4P0|EFG_METFK Elongation factor G OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fusA PE=3 SV=1 2 646 3.0E-170
sp|Q04C17|EFG_LACDB Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fusA PE=3 SV=1 1 646 3.0E-170
sp|B6JET0|EFG_OLICO Elongation factor G OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=fusA PE=3 SV=1 1 647 3.0E-170
sp|B3QY21|EFG_CHLT3 Elongation factor G OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=fusA PE=3 SV=1 1 651 3.0E-170
sp|Q1GBM0|EFG_LACDA Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=fusA PE=3 SV=1 1 646 3.0E-170
sp|Q3A9R2|EFG_CARHZ Elongation factor G OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=fusA PE=3 SV=1 1 650 4.0E-170
sp|A5D5I7|EFG_PELTS Elongation factor G OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=fusA PE=3 SV=1 1 646 4.0E-170
sp|B1I8Z9|EFG_STRPI Elongation factor G OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fusA PE=3 SV=1 1 650 4.0E-170
sp|Q318N4|EFG_PROM9 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9312) GN=fusA PE=3 SV=1 2 649 4.0E-170
sp|Q9CDG1|EFG_LACLA Elongation factor G OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fusA PE=3 SV=1 1 646 5.0E-170
sp|Q8KTB7|EFG_RICRH Elongation factor G OS=Rickettsia rhipicephali GN=fusA PE=3 SV=1 1 646 5.0E-170
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 1 646 5.0E-170
sp|Q9PPW7|EFG_UREPA Elongation factor G OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=fusA PE=3 SV=1 1 644 5.0E-170
sp|B1AJG4|EFG_UREP2 Elongation factor G OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=fusA PE=3 SV=1 1 644 5.0E-170
sp|A2RP72|EFG_LACLM Elongation factor G OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fusA PE=3 SV=1 1 646 5.0E-170
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 1 646 7.0E-170
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 1 646 8.0E-170
sp|C5BQ43|EFG_TERTT Elongation factor G OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=fusA PE=3 SV=1 1 646 8.0E-170
sp|B0VTG3|EFG_ACIBS Elongation factor G OS=Acinetobacter baumannii (strain SDF) GN=fusA PE=3 SV=1 1 649 9.0E-170
sp|Q1ISC5|EFG_KORVE Elongation factor G OS=Koribacter versatilis (strain Ellin345) GN=fusA PE=3 SV=1 1 650 9.0E-170
sp|B7GYM8|EFG_ACIB3 Elongation factor G OS=Acinetobacter baumannii (strain AB307-0294) GN=fusA PE=3 SV=1 1 649 9.0E-170
sp|Q47UW3|EFG2_COLP3 Elongation factor G 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fusA2 PE=3 SV=1 1 644 1.0E-169
sp|B0TC53|EFG_HELMI Elongation factor G OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fusA PE=3 SV=1 1 646 1.0E-169
sp|Q82DQ1|EFG_STRAW Elongation factor G OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fusA PE=3 SV=1 1 650 1.0E-169
sp|A3DIZ9|EFG_CLOTH Elongation factor G OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=fusA PE=3 SV=1 1 645 1.0E-169
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 1 646 1.0E-169
sp|B8ZKU0|EFG_STRPJ Elongation factor G OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fusA PE=3 SV=1 1 650 2.0E-169
sp|Q8KTC1|EFG_RICRI Elongation factor G OS=Rickettsia rickettsii GN=fusA PE=3 SV=1 1 646 2.0E-169
sp|Q1GK42|EFG_RUEST Elongation factor G OS=Ruegeria sp. (strain TM1040) GN=fusA PE=3 SV=1 1 647 2.0E-169
sp|Q8KTB8|EFG_RICSI Elongation factor G OS=Rickettsia sibirica GN=fusA PE=3 SV=1 1 646 2.0E-169
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 1 646 3.0E-169
sp|Q8R7V1|EFG_CALS4 Elongation factor G OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fusA PE=3 SV=1 1 645 3.0E-169
sp|C4LBU4|EFG_TOLAT Elongation factor G OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=fusA PE=3 SV=1 1 650 3.0E-169
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 2 646 4.0E-169
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 2 646 4.0E-169
sp|C1CIF3|EFG_STRZP Elongation factor G OS=Streptococcus pneumoniae (strain P1031) GN=fusA PE=3 SV=1 1 650 4.0E-169
sp|Q0BSG5|EFG_GRABC Elongation factor G OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fusA PE=3 SV=1 2 646 4.0E-169
sp|Q134S6|EFG_RHOPS Elongation factor G OS=Rhodopseudomonas palustris (strain BisB5) GN=fusA PE=3 SV=1 1 647 5.0E-169
sp|B0V8Y3|EFG_ACIBY Elongation factor G OS=Acinetobacter baumannii (strain AYE) GN=fusA PE=3 SV=1 1 649 5.0E-169
sp|A3M306|EFG_ACIBT Elongation factor G OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fusA PE=3 SV=2 1 649 5.0E-169
sp|B2HUQ4|EFG_ACIBC Elongation factor G OS=Acinetobacter baumannii (strain ACICU) GN=fusA PE=3 SV=1 1 649 5.0E-169
sp|B7I7S1|EFG_ACIB5 Elongation factor G OS=Acinetobacter baumannii (strain AB0057) GN=fusA PE=3 SV=1 1 649 5.0E-169
sp|P64023|EFG_STRR6 Elongation factor G OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fusA PE=3 SV=1 1 650 6.0E-169
sp|P64022|EFG_STRPN Elongation factor G OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fusA PE=3 SV=1 1 650 6.0E-169
sp|C1CB46|EFG_STRP7 Elongation factor G OS=Streptococcus pneumoniae (strain 70585) GN=fusA PE=3 SV=1 1 650 6.0E-169
sp|B5E6U5|EFG_STRP4 Elongation factor G OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fusA PE=3 SV=1 1 650 6.0E-169
sp|Q04MH7|EFG_STRP2 Elongation factor G OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fusA PE=3 SV=1 1 650 6.0E-169
sp|Q2YB00|EFG_NITMU Elongation factor G OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=fusA PE=3 SV=1 1 646 6.0E-169
sp|Q6FDS6|EFG_ACIAD Elongation factor G OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fusA PE=3 SV=1 1 649 7.0E-169
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 1 650 8.0E-169
sp|C1CC62|EFG_STRZJ Elongation factor G OS=Streptococcus pneumoniae (strain JJA) GN=fusA PE=3 SV=1 1 650 8.0E-169
sp|Q5WLR5|EFG_BACSK Elongation factor G OS=Bacillus clausii (strain KSM-K16) GN=fusA PE=3 SV=1 1 646 9.0E-169
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 1 646 9.0E-169
sp|C1CPE5|EFG_STRZT Elongation factor G OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fusA PE=3 SV=1 1 650 1.0E-168
sp|B2ISJ9|EFG_STRPS Elongation factor G OS=Streptococcus pneumoniae (strain CGSP14) GN=fusA PE=3 SV=1 1 650 1.0E-168
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 1 646 1.0E-168
sp|B3CLA3|EFG_WOLPP Elongation factor G OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=fusA PE=3 SV=1 1 648 2.0E-168
sp|B2G8Y0|EFG_LACRJ Elongation factor G OS=Lactobacillus reuteri (strain JCM 1112) GN=fusA PE=3 SV=1 1 646 2.0E-168
sp|A5VLK8|EFG_LACRD Elongation factor G OS=Lactobacillus reuteri (strain DSM 20016) GN=fusA PE=3 SV=1 1 646 2.0E-168
sp|B4S5N0|EFG_PROA2 Elongation factor G OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=fusA PE=3 SV=1 1 650 2.0E-168
sp|A5WGL0|EFG_PSYWF Elongation factor G OS=Psychrobacter sp. (strain PRwf-1) GN=fusA PE=3 SV=1 1 650 2.0E-168
sp|A1SNN6|EFG_NOCSJ Elongation factor G OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fusA PE=3 SV=1 1 650 2.0E-168
sp|C0MF25|EFG_STRS7 Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fusA PE=3 SV=1 1 650 3.0E-168
sp|C0M937|EFG_STRE4 Elongation factor G OS=Streptococcus equi subsp. equi (strain 4047) GN=fusA PE=3 SV=1 1 650 3.0E-168
sp|B4U0V9|EFG_STREM Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=fusA PE=3 SV=1 1 650 3.0E-168
sp|B5XJR1|EFG_STRPZ Elongation factor G OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=fusA PE=3 SV=1 1 650 3.0E-168
sp|Q0ID58|EFG_SYNS3 Elongation factor G OS=Synechococcus sp. (strain CC9311) GN=fusA PE=3 SV=1 2 649 3.0E-168
sp|B2IK59|EFG_BEII9 Elongation factor G OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=fusA PE=3 SV=1 1 647 3.0E-168
sp|B9E8Q1|EFG_MACCJ Elongation factor G OS=Macrococcus caseolyticus (strain JCSC5402) GN=fusA PE=3 SV=1 1 650 4.0E-168
sp|P0DA85|EFG_STRPQ Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fus PE=3 SV=1 1 650 5.0E-168
sp|Q48VB6|EFG_STRPM Elongation factor G OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fusA PE=3 SV=1 1 650 5.0E-168
sp|Q1J8I4|EFG_STRPF Elongation factor G OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fusA PE=3 SV=1 1 650 5.0E-168
sp|Q1JIM6|EFG_STRPD Elongation factor G OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fusA PE=3 SV=1 1 650 5.0E-168
sp|Q1JNH7|EFG_STRPC Elongation factor G OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fusA PE=3 SV=1 1 650 5.0E-168
sp|P69948|EFG_STRP8 Elongation factor G OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fus PE=3 SV=2 1 650 5.0E-168
sp|Q5XDW4|EFG_STRP6 Elongation factor G OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fus PE=1 SV=3 1 650 5.0E-168
sp|P0DA84|EFG_STRP3 Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fus PE=3 SV=1 1 650 5.0E-168
sp|P69946|EFG_STRP1 Elongation factor G OS=Streptococcus pyogenes serotype M1 GN=fus PE=3 SV=2 1 650 5.0E-168
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 1 646 5.0E-168
sp|B3QBY3|EFG_RHOPT Elongation factor G OS=Rhodopseudomonas palustris (strain TIE-1) GN=fusA PE=3 SV=1 1 647 5.0E-168
sp|Q6N4T4|EFG_RHOPA Elongation factor G OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fusA PE=3 SV=1 1 647 5.0E-168
sp|Q7VA04|EFG_PROMA Elongation factor G OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fusA PE=3 SV=1 2 649 6.0E-168
sp|C0R543|EFG_WOLWR Elongation factor G OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=fusA PE=3 SV=1 1 648 7.0E-168
sp|Q73IX7|EFG_WOLPM Elongation factor G OS=Wolbachia pipientis wMel GN=fusA PE=3 SV=1 1 648 7.0E-168
sp|Q12GX4|EFG1_POLSJ Elongation factor G 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=fusA1 PE=3 SV=1 1 645 7.0E-168
sp|B4R8L3|EFG_PHEZH Elongation factor G OS=Phenylobacterium zucineum (strain HLK1) GN=fusA PE=3 SV=1 1 647 8.0E-168
sp|Q3AW54|EFG_SYNS9 Elongation factor G OS=Synechococcus sp. (strain CC9902) GN=fusA PE=3 SV=1 2 649 9.0E-168
sp|Q5GWS9|EFG_XANOR Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fusA PE=3 SV=2 1 646 9.0E-168
sp|Q2NZY2|EFG_XANOM Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fusA PE=3 SV=1 1 646 9.0E-168
sp|Q2IJ93|EFG1_ANADE Elongation factor G 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=fusA1 PE=3 SV=1 1 646 1.0E-167
sp|C1F645|EFG_ACIC5 Elongation factor G OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=fusA PE=3 SV=1 1 650 1.0E-167
sp|A0L5X0|EFG_MAGMM Elongation factor G OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=fusA PE=3 SV=1 1 646 1.0E-167
sp|A6W5T4|EFG_KINRD Elongation factor G OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=fusA PE=3 SV=1 1 650 1.0E-167
sp|A5N4P4|EFG_CLOK5 Elongation factor G OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=fusA PE=3 SV=1 1 646 2.0E-167
sp|B9DYA6|EFG_CLOK1 Elongation factor G OS=Clostridium kluyveri (strain NBRC 12016) GN=fusA PE=3 SV=1 1 646 2.0E-167
sp|C0ZVT6|EFG_RHOE4 Elongation factor G OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=fusA PE=3 SV=1 2 650 2.0E-167
sp|Q2IXR3|EFG_RHOP2 Elongation factor G OS=Rhodopseudomonas palustris (strain HaA2) GN=fusA PE=3 SV=1 1 647 2.0E-167
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 1 650 2.0E-167
sp|A7HM55|EFG_FERNB Elongation factor G OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=fusA PE=3 SV=1 1 644 3.0E-167
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 1 646 3.0E-167
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 1 646 3.0E-167
sp|A5GW13|EFG_SYNR3 Elongation factor G OS=Synechococcus sp. (strain RCC307) GN=fusA PE=3 SV=1 2 649 3.0E-167
sp|A8EXK1|EFG_RICCK Elongation factor G OS=Rickettsia canadensis (strain McKiel) GN=fusA PE=3 SV=1 1 646 3.0E-167
sp|Q5GSU1|EFG_WOLTR Elongation factor G OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=fusA PE=3 SV=1 1 643 3.0E-167
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 1 646 3.0E-167
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 1 646 4.0E-167
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 1 646 4.0E-167
sp|A2BYN5|EFG_PROM5 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9515) GN=fusA PE=3 SV=1 2 649 4.0E-167
sp|A2RCI2|EFG_STRPG Elongation factor G OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fusA PE=3 SV=1 1 650 5.0E-167
sp|Q0TMP3|EFG_CLOP1 Elongation factor G OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=fusA PE=3 SV=1 1 646 6.0E-167
sp|Q8KTB0|EFG_RICBE Elongation factor G OS=Rickettsia bellii GN=fusA PE=3 SV=1 1 646 6.0E-167
sp|A8GV17|EFG_RICB8 Elongation factor G OS=Rickettsia bellii (strain OSU 85-389) GN=fusA PE=3 SV=1 1 646 6.0E-167
sp|Q2W2I8|EFG_MAGSA Elongation factor G OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fusA PE=3 SV=1 1 646 7.0E-167
sp|Q2KV83|EFG2_BORA1 Elongation factor G 2 OS=Bordetella avium (strain 197N) GN=fusA2 PE=3 SV=1 1 645 7.0E-167
sp|Q13TG7|EFG2_BURXL Elongation factor G 2 OS=Burkholderia xenovorans (strain LB400) GN=fusA2 PE=3 SV=1 1 644 8.0E-167
sp|B0S0I4|EFG_FINM2 Elongation factor G OS=Finegoldia magna (strain ATCC 29328) GN=fusA PE=3 SV=1 1 646 1.0E-166
sp|Q0AIJ8|EFG_NITEC Elongation factor G OS=Nitrosomonas eutropha (strain C91) GN=fusA PE=3 SV=1 1 646 1.0E-166
sp|B0K5P0|EFG_THEPX Elongation factor G OS=Thermoanaerobacter sp. (strain X514) GN=fusA PE=3 SV=1 1 646 1.0E-166
sp|B0KCJ7|EFG_THEP3 Elongation factor G OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=fusA PE=3 SV=1 1 646 1.0E-166
sp|C1AYS4|EFG_RHOOB Elongation factor G OS=Rhodococcus opacus (strain B4) GN=fusA PE=3 SV=1 2 650 1.0E-166
sp|Q9A3K4|EFG_CAUCR Elongation factor G OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fusA PE=3 SV=1 1 647 2.0E-166
sp|B8H414|EFG_CAUCN Elongation factor G OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=fusA PE=3 SV=1 1 647 2.0E-166
sp|A5V605|EFG_SPHWW Elongation factor G OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=fusA PE=3 SV=1 1 646 2.0E-166
sp|Q89J81|EFG_BRADU Elongation factor G OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fusA PE=3 SV=1 1 647 2.0E-166
sp|Q2RQV7|EFG_RHORT Elongation factor G OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=fusA PE=3 SV=1 1 646 2.0E-166
sp|B9DVS2|EFG_STRU0 Elongation factor G OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fusA PE=3 SV=1 1 650 2.0E-166
sp|A9B746|EFG_HERA2 Elongation factor G OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=fusA PE=3 SV=1 1 649 2.0E-166
sp|Q0SFF3|EFG_RHOJR Elongation factor G OS=Rhodococcus jostii (strain RHA1) GN=fusA PE=3 SV=1 2 650 2.0E-166
sp|B9LJC8|EFG_CHLSY Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fusA PE=3 SV=1 1 649 3.0E-166
sp|A9WH62|EFG_CHLAA Elongation factor G OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fusA PE=3 SV=1 1 649 3.0E-166
sp|Q160Y3|EFG_ROSDO Elongation factor G OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=fusA PE=3 SV=1 1 647 3.0E-166
sp|Q30TP3|EFG_SULDN Elongation factor G OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=fusA PE=3 SV=1 1 646 3.0E-166
sp|Q2T0I7|EFG1_BURTA Elongation factor G 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA1 PE=3 SV=1 1 648 3.0E-166
sp|Q5LMR4|EFG_RUEPO Elongation factor G OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=fusA PE=3 SV=1 1 647 4.0E-166
sp|Q1LSY5|EFG_BAUCH Elongation factor G OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=fusA PE=3 SV=1 1 650 4.0E-166
sp|A1A0T0|EFG_BIFAA Elongation factor G OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=fusA PE=3 SV=1 1 650 5.0E-166
sp|B1KSM8|EFG_CLOBM Elongation factor G OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=fusA PE=3 SV=1 1 646 5.0E-166
sp|C1FMV4|EFG_CLOBJ Elongation factor G OS=Clostridium botulinum (strain Kyoto / Type A2) GN=fusA PE=3 SV=1 1 646 5.0E-166
sp|A9BCK1|EFG_PROM4 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9211) GN=fusA PE=3 SV=1 2 649 6.0E-166
sp|A8LM45|EFG_DINSH Elongation factor G OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=fusA PE=3 SV=1 1 647 6.0E-166
sp|A5CUB7|EFG_CLAM3 Elongation factor G OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=fusA PE=3 SV=1 1 650 6.0E-166
sp|Q8D3H2|EFG_WIGBR Elongation factor G OS=Wigglesworthia glossinidia brevipalpis GN=fusA PE=3 SV=1 1 648 7.0E-166
sp|Q1RHC3|EFG_RICBR Elongation factor G OS=Rickettsia bellii (strain RML369-C) GN=fusA PE=3 SV=1 1 646 9.0E-166
sp|Q28UW8|EFG_JANSC Elongation factor G OS=Jannaschia sp. (strain CCS1) GN=fusA PE=3 SV=1 1 647 1.0E-165
sp|A5ELN0|EFG_BRASB Elongation factor G OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fusA PE=3 SV=1 1 647 1.0E-165
sp|B2HSL2|EFG_MYCMM Elongation factor G OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fusA PE=3 SV=1 1 650 1.0E-165
sp|B6J266|EFG_COXB2 Elongation factor G OS=Coxiella burnetii (strain CbuG_Q212) GN=fusA PE=3 SV=1 1 646 2.0E-165
sp|A0PM41|EFG_MYCUA Elongation factor G OS=Mycobacterium ulcerans (strain Agy99) GN=fusA PE=3 SV=1 1 650 2.0E-165
sp|Q0SQE1|EFG_CLOPS Elongation factor G OS=Clostridium perfringens (strain SM101 / Type A) GN=fusA PE=3 SV=1 1 646 2.0E-165
sp|Q8XHS1|EFG_CLOPE Elongation factor G OS=Clostridium perfringens (strain 13 / Type A) GN=fusA PE=3 SV=1 1 646 2.0E-165
sp|Q83ES7|EFG_COXBU Elongation factor G OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fusA PE=3 SV=1 1 646 2.0E-165
sp|A9NAM1|EFG_COXBR Elongation factor G OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=fusA PE=3 SV=1 1 646 2.0E-165
sp|C3KVQ4|EFG_CLOB6 Elongation factor G OS=Clostridium botulinum (strain 657 / Type Ba4) GN=fusA PE=3 SV=1 1 646 2.0E-165
sp|Q8XV10|EFG1_RALSO Elongation factor G 1 OS=Ralstonia solanacearum (strain GMI1000) GN=fusA PE=3 SV=1 1 645 2.0E-165
sp|Q1LI29|EFG1_CUPMC Elongation factor G 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=fusA1 PE=3 SV=1 1 639 2.0E-165
sp|Q890N8|EFG_CLOTE Elongation factor G OS=Clostridium tetani (strain Massachusetts / E88) GN=fusA PE=3 SV=1 1 646 3.0E-165
sp|C4K4F9|EFG_HAMD5 Elongation factor G OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=fusA PE=3 SV=1 1 657 3.0E-165
sp|B6J5C9|EFG_COXB1 Elongation factor G OS=Coxiella burnetii (strain CbuK_Q154) GN=fusA PE=3 SV=1 1 646 3.0E-165
sp|Q4L3K8|EFG_STAHJ Elongation factor G OS=Staphylococcus haemolyticus (strain JCSC1435) GN=fusA PE=3 SV=1 1 650 3.0E-165
sp|B0RB35|EFG_CLAMS Elongation factor G OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=fusA PE=3 SV=1 1 650 3.0E-165
sp|Q8EX19|EFG_MYCPE Elongation factor G OS=Mycoplasma penetrans (strain HF-2) GN=fusA PE=3 SV=1 1 642 3.0E-165
sp|A5EX85|EFG_DICNV Elongation factor G OS=Dichelobacter nodosus (strain VCS1703A) GN=fusA PE=3 SV=1 1 644 3.0E-165
sp|Q07KL5|EFG_RHOP5 Elongation factor G OS=Rhodopseudomonas palustris (strain BisA53) GN=fusA PE=3 SV=1 1 647 4.0E-165
sp|Q46WE0|EFG1_CUPPJ Elongation factor G 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=fusA1 PE=3 SV=1 1 645 4.0E-165
sp|A9KD34|EFG_COXBN Elongation factor G OS=Coxiella burnetii (strain Dugway 5J108-111) GN=fusA PE=3 SV=1 1 646 6.0E-165
sp|Q63WJ7|EFG1_BURPS Elongation factor G 1 OS=Burkholderia pseudomallei (strain K96243) GN=fusA1 PE=3 SV=1 1 648 6.0E-165
sp|Q62HK4|EFG1_BURMA Elongation factor G 1 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA1 PE=3 SV=1 1 648 6.0E-165
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 1 646 6.0E-165
sp|Q8CQ82|EFG_STAES Elongation factor G OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fusA PE=3 SV=3 1 650 7.0E-165
sp|Q5HRK5|EFG_STAEQ Elongation factor G OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fusA PE=3 SV=3 1 650 7.0E-165
sp|B8ELG6|EFG_METSB Elongation factor G OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=fusA PE=3 SV=1 1 647 7.0E-165
sp|Q3JV86|EFG1_BURP1 Elongation factor G 1 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA1 PE=3 SV=2 1 648 8.0E-165
sp|A6T3K7|EFG_JANMA Elongation factor G OS=Janthinobacterium sp. (strain Marseille) GN=fusA PE=3 SV=1 1 644 9.0E-165
sp|Q839G9|EFG_ENTFA Elongation factor G OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fusA PE=3 SV=1 1 646 9.0E-165
sp|B4EYV7|EFG_PROMH Elongation factor G OS=Proteus mirabilis (strain HI4320) GN=fusA PE=3 SV=1 1 650 9.0E-165
sp|Q3ILP5|EFG1_PSEHT Elongation factor G 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fusA1 PE=3 SV=1 1 645 1.0E-164
sp|Q089Q7|EFG1_SHEFN Elongation factor G 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=fusA1 PE=3 SV=1 2 644 1.0E-164
sp|Q2NQL6|EFG_SODGM Elongation factor G OS=Sodalis glossinidius (strain morsitans) GN=fusA PE=3 SV=1 1 657 1.0E-164
sp|Q2S909|EFG1_HAHCH Elongation factor G 1 OS=Hahella chejuensis (strain KCTC 2396) GN=fusA1 PE=3 SV=1 1 645 1.0E-164
sp|A1T4L5|EFG_MYCVP Elongation factor G OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=fusA PE=3 SV=1 1 646 1.0E-164
sp|A2S7H3|EFG_BURM9 Elongation factor G OS=Burkholderia mallei (strain NCTC 10229) GN=fusA PE=3 SV=1 1 645 1.0E-164
sp|Q2SU24|EFG2_BURTA Elongation factor G 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA2 PE=3 SV=1 1 645 1.0E-164
sp|Q63Q08|EFG2_BURPS Elongation factor G 2 OS=Burkholderia pseudomallei (strain K96243) GN=fusA2 PE=3 SV=1 1 645 1.0E-164
sp|Q3JMR0|EFG2_BURP1 Elongation factor G 2 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA2 PE=3 SV=1 1 645 1.0E-164
sp|Q62GK2|EFG2_BURMA Elongation factor G 2 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA2 PE=3 SV=1 1 645 1.0E-164
sp|Q1BU86|EFG1_BURCA Elongation factor G 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA1 PE=3 SV=2 1 644 2.0E-164
sp|C0ZIH5|EFG_BREBN Elongation factor G OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=fusA PE=3 SV=1 1 650 2.0E-164
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 1 649 2.0E-164
sp|Q1QN33|EFG_NITHX Elongation factor G OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fusA PE=3 SV=1 1 647 2.0E-164
sp|Q3J8R1|EFG_NITOC Elongation factor G OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fusA PE=3 SV=1 1 648 3.0E-164
sp|Q5P335|EFG_AROAE Elongation factor G OS=Aromatoleum aromaticum (strain EbN1) GN=fusA PE=3 SV=1 1 644 4.0E-164
sp|A4T1R3|EFG_MYCGI Elongation factor G OS=Mycobacterium gilvum (strain PYR-GCK) GN=fusA PE=3 SV=1 2 646 4.0E-164
sp|A4J108|EFG_DESRM Elongation factor G OS=Desulfotomaculum reducens (strain MI-1) GN=fusA PE=3 SV=1 1 646 4.0E-164
sp|A1KB30|EFG_AZOSB Elongation factor G OS=Azoarcus sp. (strain BH72) GN=fusA PE=3 SV=1 1 645 5.0E-164
sp|P75544|EFG_MYCPN Elongation factor G OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=fusA PE=3 SV=1 1 645 5.0E-164
sp|Q7V501|EFG_PROMM Elongation factor G OS=Prochlorococcus marinus (strain MIT 9313) GN=fusA PE=3 SV=1 2 649 5.0E-164
sp|A2CC86|EFG_PROM3 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9303) GN=fusA PE=3 SV=1 2 649 5.0E-164
sp|Q3B6G4|EFG_CHLL7 Elongation factor G OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=fusA PE=3 SV=1 1 643 5.0E-164
sp|Q1BRU5|EFG2_BURCA Elongation factor G 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA2 PE=3 SV=1 1 645 6.0E-164
sp|Q73SD2|EFG_MYCPA Elongation factor G OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=fusA PE=3 SV=1 1 646 7.0E-164
sp|A0QL36|EFG_MYCA1 Elongation factor G OS=Mycobacterium avium (strain 104) GN=fusA PE=3 SV=1 1 646 7.0E-164
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 1 650 7.0E-164
sp|Q82T70|EFG_NITEU Elongation factor G OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fusA PE=3 SV=1 1 646 8.0E-164
sp|Q88FI4|EFG2_PSEPK Elongation factor G 2 OS=Pseudomonas putida (strain KT2440) GN=fusB PE=3 SV=1 1 650 8.0E-164
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 1 646 9.0E-164
sp|Q03EB4|EFG_PEDPA Elongation factor G OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=fusA PE=3 SV=1 1 646 9.0E-164
sp|A1B023|EFG_PARDP Elongation factor G OS=Paracoccus denitrificans (strain Pd 1222) GN=fusA PE=3 SV=1 1 647 1.0E-163
sp|A1AVJ7|EFG_RUTMC Elongation factor G OS=Ruthia magnifica subsp. Calyptogena magnifica GN=fusA PE=3 SV=1 1 646 1.0E-163
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 2 646 1.0E-163
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 2 646 1.0E-163
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 2 646 1.0E-163
sp|Q30Z38|EFG_DESAG Elongation factor G OS=Desulfovibrio alaskensis (strain G20) GN=fusA PE=3 SV=1 1 650 1.0E-163
sp|Q47JA6|EFG_DECAR Elongation factor G OS=Dechloromonas aromatica (strain RCB) GN=fusA PE=3 SV=1 1 646 1.0E-163
sp|Q18CF4|EFG_PEPD6 Elongation factor G OS=Peptoclostridium difficile (strain 630) GN=fusA PE=3 SV=1 1 643 2.0E-163
sp|Q39KH0|EFG1_BURL3 Elongation factor G 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fusA1 PE=3 SV=1 1 645 2.0E-163
sp|B8G6S9|EFG_CHLAD Elongation factor G OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=fusA PE=3 SV=1 1 649 2.0E-163
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 1 646 2.0E-163
sp|Q7WFL2|EFG2_BORBR Elongation factor G 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA2 PE=3 SV=1 1 644 2.0E-163
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 1 646 2.0E-163
sp|B3CTE7|EFG_ORITI Elongation factor G OS=Orientia tsutsugamushi (strain Ikeda) GN=fusA PE=3 SV=1 1 646 2.0E-163
sp|A5CF23|EFG_ORITB Elongation factor G OS=Orientia tsutsugamushi (strain Boryong) GN=fusA PE=3 SV=1 1 646 2.0E-163
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 1 650 2.0E-163
sp|Q1AU26|EFG_RUBXD Elongation factor G OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fusA PE=3 SV=1 1 646 2.0E-163
sp|Q3AMT5|EFG_SYNSC Elongation factor G OS=Synechococcus sp. (strain CC9605) GN=fusA PE=3 SV=1 2 649 2.0E-163
sp|A1TJ04|EFG_ACIAC Elongation factor G OS=Acidovorax citrulli (strain AAC00-1) GN=fusA PE=3 SV=1 1 645 3.0E-163
sp|Q0BYB1|EFG_HYPNA Elongation factor G OS=Hyphomonas neptunium (strain ATCC 15444) GN=fusA PE=3 SV=1 1 636 3.0E-163
sp|Q21RV5|EFG_RHOFT Elongation factor G OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=fusA PE=3 SV=1 1 645 3.0E-163
sp|B9KL88|EFG_RHOSK Elongation factor G OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=fusA PE=3 SV=1 1 647 3.0E-163
sp|Q83NA0|EFG_TROW8 Elongation factor G OS=Tropheryma whipplei (strain TW08/27) GN=fusA PE=3 SV=1 1 650 3.0E-163
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 1 646 3.0E-163
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4610
MDSMELEREKGITIQSAATFCDWKRTEDGKEETYHFNLIDTPGHIDFTIEVERALRVLDGAVMILCAVSGVQSQT
TTVDRQMKRYNVPRISFINKMDRMGADPWKAIEQINAKLKMPAAAIQIPIGAEDEFEGVVDLIEMKALYFEGPRG
TKVRVSDQVPGGLLDLAAEKRQLLIEKLADVDEDIAEIFLDEKEPTKAQLKAAIRRATIARAFSPVLMGSALADK
AVQPMLDAVCDYLPNPSQVDNTALDRSRGEQPVKLVPYNSLPFVGLAFKLEENNFGQLTYIRVYQGTLSKGSYLY
NSRTDKKVRVPRIVRMHSNEMEDVSEVGAGEICAVFGVDCASGDTFTDGGLPYTMSSMFVPDAVMSLSISPKRTA
DGDHFSKAMNRFQREDPTFRVHVDPESEETIISGMGELHLEVYVERLRREYKTDCVTGQPRVAYRETISRRADFD
YLLKRQTGGPGDFARVGGWIEPNEKPEENSYESQVVGGHIPDKFLTACAKGFDLACEKGPLLGHRVIGTRMVVND
GATHVTDSSDYAFSLATQMAFRKAFSDAGGQVLEPLMKTTITAPNEFQGNILMLMNKRNATIHDTDIGGEDFTLV
CDCSLNAMFGFSSQLRAATQGKGEFSMEFSHYSPAPPHLQKELVAKYQAELESKRTK*
Coding >Hirsu2|4610
ATGGACTCTATGGAGTTGGAAAGGGAAAAGGGAATCACGATCCAGTCTGCGGCCACCTTTTGCGACTGGAAAAGG
ACCGAGGATGGCAAGGAAGAGACCTACCACTTCAATTTGATCGATACCCCAGGCCATATTGACTTCACCATTGAA
GTCGAACGCGCTCTTCGAGTCTTGGATGGCGCTGTCATGATTCTGTGTGCTGTCAGCGGTGTTCAGTCACAAACT
ACCACGGTTGACCGGCAGATGAAACGTTACAACGTTCCACGAATCTCCTTCATTAACAAGATGGATCGCATGGGC
GCCGATCCCTGGAAAGCTATTGAACAGATTAACGCTAAGCTCAAAATGCCAGCTGCCGCCATCCAGATCCCTATC
GGAGCCGAGGACGAATTTGAGGGCGTCGTTGACTTGATCGAAATGAAGGCTTTGTATTTTGAAGGCCCTCGCGGA
ACCAAGGTCAGGGTCTCGGATCAAGTCCCGGGCGGGCTCCTGGACCTTGCGGCCGAAAAGCGTCAACTCCTGATT
GAGAAATTGGCAGACGTTGACGAGGATATTGCCGAAATCTTTCTTGACGAGAAAGAGCCTACAAAGGCGCAGCTG
AAAGCGGCCATCCGCCGCGCCACCATTGCCCGCGCCTTTTCCCCCGTGCTGATGGGGTCAGCCCTGGCTGATAAG
GCCGTCCAGCCCATGCTTGATGCTGTCTGCGACTACCTCCCAAATCCATCCCAGGTCGACAATACTGCCCTGGAC
AGATCCAGAGGCGAACAGCCGGTTAAGCTCGTGCCGTACAACTCCCTGCCATTCGTTGGATTGGCGTTCAAACTG
GAGGAGAATAATTTTGGACAGCTTACGTACATTCGTGTCTACCAAGGCACCCTCAGCAAAGGTTCGTACCTGTAC
AACTCGAGAACGGACAAGAAGGTGAGGGTTCCCCGCATCGTTCGCATGCACTCGAACGAGATGGAAGACGTCTCC
GAGGTTGGCGCCGGTGAAATTTGCGCCGTCTTTGGTGTCGACTGTGCGTCGGGCGATACATTCACAGACGGAGGA
CTTCCCTATACCATGTCATCAATGTTTGTTCCCGACGCCGTCATGTCTCTTTCCATCAGCCCGAAACGTACTGCC
GACGGAGATCATTTCAGCAAGGCCATGAACAGATTTCAGCGGGAGGACCCTACTTTCCGAGTTCATGTAGACCCG
GAAAGCGAAGAGACAATCATCTCAGGCATGGGGGAGCTACACCTCGAGGTTTATGTTGAACGCTTACGGCGCGAG
TACAAGACCGATTGTGTCACAGGCCAGCCTCGTGTGGCCTACAGGGAGACAATCTCCCGACGTGCCGATTTTGAT
TATCTTCTCAAGCGGCAGACCGGTGGGCCTGGTGACTTCGCACGCGTGGGTGGCTGGATCGAGCCCAACGAGAAG
CCGGAGGAAAACAGCTACGAGAGTCAGGTTGTGGGTGGTCACATTCCCGACAAATTCCTGACGGCTTGCGCCAAA
GGATTCGACCTGGCCTGCGAAAAGGGTCCTCTACTTGGACACAGAGTTATCGGGACAAGAATGGTCGTCAACGAC
GGTGCCACCCATGTGACGGACTCCTCTGACTACGCGTTCAGTCTCGCCACGCAGATGGCTTTTCGGAAAGCATTT
TCCGACGCTGGCGGCCAGGTGCTGGAGCCGTTGATGAAGACGACCATAACGGCTCCAAACGAATTTCAGGGAAAC
ATTCTGATGCTCATGAATAAGAGAAACGCGACTATCCACGATACTGATATCGGTGGCGAGGACTTCACATTGGTT
TGCGACTGCAGTCTCAATGCCATGTTCGGCTTCAGCTCGCAATTGCGGGCCGCTACGCAGGGCAAGGGGGAGTTT
AGTATGGAGTTCAGCCATTACTCTCCAGCGCCTCCTCACCTACAAAAGGAGTTGGTAGCGAAGTACCAGGCCGAA
TTAGAGTCGAAGAGAACAAAATAG
Transcript >Hirsu2|4610
ATGGACTCTATGGAGTTGGAAAGGGAAAAGGGAATCACGATCCAGTCTGCGGCCACCTTTTGCGACTGGAAAAGG
ACCGAGGATGGCAAGGAAGAGACCTACCACTTCAATTTGATCGATACCCCAGGCCATATTGACTTCACCATTGAA
GTCGAACGCGCTCTTCGAGTCTTGGATGGCGCTGTCATGATTCTGTGTGCTGTCAGCGGTGTTCAGTCACAAACT
ACCACGGTTGACCGGCAGATGAAACGTTACAACGTTCCACGAATCTCCTTCATTAACAAGATGGATCGCATGGGC
GCCGATCCCTGGAAAGCTATTGAACAGATTAACGCTAAGCTCAAAATGCCAGCTGCCGCCATCCAGATCCCTATC
GGAGCCGAGGACGAATTTGAGGGCGTCGTTGACTTGATCGAAATGAAGGCTTTGTATTTTGAAGGCCCTCGCGGA
ACCAAGGTCAGGGTCTCGGATCAAGTCCCGGGCGGGCTCCTGGACCTTGCGGCCGAAAAGCGTCAACTCCTGATT
GAGAAATTGGCAGACGTTGACGAGGATATTGCCGAAATCTTTCTTGACGAGAAAGAGCCTACAAAGGCGCAGCTG
AAAGCGGCCATCCGCCGCGCCACCATTGCCCGCGCCTTTTCCCCCGTGCTGATGGGGTCAGCCCTGGCTGATAAG
GCCGTCCAGCCCATGCTTGATGCTGTCTGCGACTACCTCCCAAATCCATCCCAGGTCGACAATACTGCCCTGGAC
AGATCCAGAGGCGAACAGCCGGTTAAGCTCGTGCCGTACAACTCCCTGCCATTCGTTGGATTGGCGTTCAAACTG
GAGGAGAATAATTTTGGACAGCTTACGTACATTCGTGTCTACCAAGGCACCCTCAGCAAAGGTTCGTACCTGTAC
AACTCGAGAACGGACAAGAAGGTGAGGGTTCCCCGCATCGTTCGCATGCACTCGAACGAGATGGAAGACGTCTCC
GAGGTTGGCGCCGGTGAAATTTGCGCCGTCTTTGGTGTCGACTGTGCGTCGGGCGATACATTCACAGACGGAGGA
CTTCCCTATACCATGTCATCAATGTTTGTTCCCGACGCCGTCATGTCTCTTTCCATCAGCCCGAAACGTACTGCC
GACGGAGATCATTTCAGCAAGGCCATGAACAGATTTCAGCGGGAGGACCCTACTTTCCGAGTTCATGTAGACCCG
GAAAGCGAAGAGACAATCATCTCAGGCATGGGGGAGCTACACCTCGAGGTTTATGTTGAACGCTTACGGCGCGAG
TACAAGACCGATTGTGTCACAGGCCAGCCTCGTGTGGCCTACAGGGAGACAATCTCCCGACGTGCCGATTTTGAT
TATCTTCTCAAGCGGCAGACCGGTGGGCCTGGTGACTTCGCACGCGTGGGTGGCTGGATCGAGCCCAACGAGAAG
CCGGAGGAAAACAGCTACGAGAGTCAGGTTGTGGGTGGTCACATTCCCGACAAATTCCTGACGGCTTGCGCCAAA
GGATTCGACCTGGCCTGCGAAAAGGGTCCTCTACTTGGACACAGAGTTATCGGGACAAGAATGGTCGTCAACGAC
GGTGCCACCCATGTGACGGACTCCTCTGACTACGCGTTCAGTCTCGCCACGCAGATGGCTTTTCGGAAAGCATTT
TCCGACGCTGGCGGCCAGGTGCTGGAGCCGTTGATGAAGACGACCATAACGGCTCCAAACGAATTTCAGGGAAAC
ATTCTGATGCTCATGAATAAGAGAAACGCGACTATCCACGATACTGATATCGGTGGCGAGGACTTCACATTGGTT
TGCGACTGCAGTCTCAATGCCATGTTCGGCTTCAGCTCGCAATTGCGGGCCGCTACGCAGGGCAAGGGGGAGTTT
AGTATGGAGTTCAGCCATTACTCTCCAGCGCCTCCTCACCTACAAAAGGAGTTGGTAGCGAAGTACCAGGCCGAA
TTAGAGTCGAAGAGAACAAAATAG
Gene >Hirsu2|4610
ATGGACTCTATGGAGTTGGAAAGGGAAAAGGGAATCACGATCCAGTCTGCGGCCACCTTTTGCGACTGGAAAAGG
ACCGAGGATGGCAAGGAAGAGACCTACCACTTCAATTTGATCGATACCCCAGGCCATATTGACTTCACCATTGAA
GTCGAACGCGCTCTTCGAGTCTTGGATGGCGCTGTCATGATTCTGTGTGCTGTCAGCGGTGTTCAGTCACAAACT
ACCACGGTTGACCGGCAGATGAAACGTTACAACGTTCCACGAATCTCCTTCATTAACAAGATGGATCGCATGGGC
GCCGATCCCTGGAAAGCTATTGAACAGATTAACGCTAAGCTCAAAATGCCAGCTGCCGCCATCCAGATCCCTATC
GGAGCCGAGGACGAATTTGAGGGCGTCGTTGACTTGATCGAAATGAAGGCTTTGTATTTTGAAGGCCCTCGCGGA
ACCAAGGTCAGGGTCTCGGATCAAGTCCCGGGCGGGCTCCTGGACCTTGCGGCCGAAAAGCGTCAACTCCTGATT
GAGAAATTGGCAGACGTTGACGAGGATATTGCCGAAATCTTTCTTGACGAGAAAGAGCCTACAAAGGCGCAGCTG
AAAGCGGCCATCCGCCGCGCCACCATTGCCCGCGCCTTTTCCCCCGTGCTGATGGGGTCAGCCCTGGCTGATAAG
GCCGTCCAGCCCATGCTTGATGCTGTCTGCGACTACCTCCCAAATCCATCCCAGGTCGACAATACTGCCCTGGAC
AGATCCAGAGGCGAACAGCCGGTTAAGCTCGTGCCGTACAACTCCCTGCCATTCGTTGGATTGGCGTTCAAACTG
GAGGAGAATAATTTTGGACAGCTTACGTACATTCGTGTCTACCAAGGCACCCTCAGCAAAGGTTCGTACCTGTAC
AACTCGAGAACGGACAAGAAGGTGAGGGTTCCCCGCATCGTTCGCATGCACTCGAACGAGATGGAAGACGTCTCC
GAGGTTGGCGCCGGTGAAATTTGCGCCGTCTTTGGTGTCGACTGTGCGTCGGGCGATACATTCACAGACGGAGGA
CTTCCCTATACCATGTCATCAATGTTTGTTCCCGACGCCGTCATGTCTCTTTCCATCAGCCCGAAACGTACTGCC
GACGGAGATCATTTCAGCAAGGCCATGAACAGATTTCAGCGGGAGGACCCTACTTTCCGAGTTCATGTAGACCCG
GAAAGCGAAGAGACAATCATCTCAGGCATGGGGGAGCTACACCTCGAGGTTTATGTTGAACGCTTACGGCGCGAG
TACAAGACCGATTGTGTCACAGGCCAGCCTCGTGTGGCCTACAGGGAGACAATCTCCCGACGTGCCGATTTTGAT
TATCTTCTCAAGCGGCAGACCGGTGGGCCTGGTGACTTCGCACGCGTGGGTGGCTGGATCGAGCCCAACGAGAAG
CCGGAGGAAAACAGCTACGAGAGTCAGGTTGTGGGTGGTCACATTCCCGACAAATTCCTGACGGCTTGCGCCAAA
GGATTCGACCTGGCCTGCGAAAAGGGTCCTCTACTTGGACACAGAGTTATCGGGACAAGAATGGTCGTCAACGAC
GGTGCCACCCATGTGACGGACTCCTCTGACTACGCGTTCAGTCTCGCCACGCAGATGGCTTTTCGGAAAGCATTT
TCCGACGCTGGCGGCCAGGTGCTGGAGCCGTTGATGAAGACGACCATAACGGCTCCAAACGAATTTCAGGGAAAC
ATTCTGATGCTCATGAATAAGAGAAACGCGACTATCCACGATACTGATATCGGTGGCGAGGACTTCACATTGGTT
TGCGACTGCAGTCTCAATGCCATGTTCGGCTTCAGCTCGCAATTGCGGGCCGCTACGCAGGGCAAGGGGGAGTTT
AGTATGGAGTTCAGCCATTACTCTCCAGCGCCTCCTCACCTACAGTAAGTCATTTCCCTGAAGATGCCATGTATT
TTGATGTCACCTGTGTCCGTGTTAACCATGCTTGCGCTTGCAGAAAGGAGTTGGTAGCGAAGTACCAGGCCGAAT
TAGAGTCGAAGAGAACAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail