Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4597
Gene name
LocationContig_233:1126..2545
Strand-
Gene length (bp)1419
Transcript length (bp)933
Coding sequence length (bp)933
Protein length (aa) 311

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 3.8E-21 34 201
PF00026 Asp Eukaryotic aspartyl protease 6.7E-09 211 285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 27 286 3.0E-15
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 33 285 1.0E-13
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 33 285 1.0E-13
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 18 284 1.0E-10
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 2 294 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 27 286 3.0E-15
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 33 285 1.0E-13
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 33 285 1.0E-13
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 18 284 1.0E-10
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 2 294 3.0E-10
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 5 294 4.0E-10
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 2 294 7.0E-10
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 21 204 1.0E-09
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 27 201 1.0E-09
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 30 200 2.0E-09
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 18 205 2.0E-09
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 37 200 3.0E-09
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 18 205 3.0E-09
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 2 235 4.0E-09
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 20 200 5.0E-09
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 20 285 1.0E-08
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 31 287 1.0E-08
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 20 285 1.0E-08
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 20 285 1.0E-08
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 37 200 2.0E-08
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 37 200 2.0E-08
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 31 287 2.0E-08
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 7 200 3.0E-08
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 36 200 4.0E-08
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 18 200 5.0E-08
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 36 287 6.0E-08
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 37 200 7.0E-08
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 22 204 9.0E-08
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 22 284 1.0E-07
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 36 287 1.0E-07
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 37 204 1.0E-07
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 18 200 1.0E-07
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 21 200 1.0E-07
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 36 287 2.0E-07
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 21 200 3.0E-07
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 21 200 4.0E-07
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 33 200 5.0E-07
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 25 287 6.0E-07
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 36 287 7.0E-07
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 31 200 8.0E-07
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 37 200 1.0E-06
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 37 200 1.0E-06
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 33 200 1.0E-06
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 37 200 3.0E-06
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 37 204 4.0E-06
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 36 200 6.0E-06
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 2 287 6.0E-06
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 17 204 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4597
MIPPTPDNSSLTQDIGKRQVHRPLIPDRSRSFFAMEVRIGEPAQSVLVDVDTGSKYNWVLGLSGDPGPDARFYFN
VSKSPTFQKGNNSVTWKYGSQRTKWAMTADEGRDLWSLGGKTLGYMRFGVSSGGPFPFNRGILGLSFPDPASKTD
SLLDKLVVARMTQSRAYSIDIGPTSRNKGFITFGGVDTAKFTGPLQKIPVEDFGRPKPKQTDCALRNRHDTVDFR
FGDFATIKVPFSDFIASYRGLKDCIFGAQLTDGAPILGRPFLRSAYVVFDQDNRNVHLAQSADCGSALTPITNGS
DAVPAVSGRC*
Coding >Hirsu2|4597
ATGATCCCCCCAACGCCCGATAATTCCTCTCTTACGCAGGATATCGGCAAGCGTCAAGTCCACAGACCGTTAATA
CCCGATCGCAGTCGTTCGTTCTTCGCTATGGAGGTGCGAATCGGTGAACCGGCTCAGAGTGTCTTGGTGGACGTG
GATACCGGCTCCAAATATAACTGGGTGTTGGGACTCTCCGGCGACCCGGGACCCGACGCTCGCTTCTACTTTAAT
GTAAGCAAGAGCCCGACATTTCAGAAAGGCAACAATTCTGTGACATGGAAATACGGGAGCCAAAGAACAAAGTGG
GCCATGACAGCCGACGAAGGTAGGGACCTCTGGTCCCTGGGCGGCAAGACTCTGGGGTATATGCGCTTTGGCGTT
TCGTCAGGCGGACCTTTTCCTTTCAATAGGGGCATTTTAGGTCTCTCCTTTCCAGACCCGGCCTCCAAAACCGAC
TCCCTATTGGACAAGCTAGTTGTAGCAAGGATGACACAAAGCCGGGCTTATAGCATTGATATCGGTCCCACTTCA
AGGAACAAGGGATTCATCACCTTCGGTGGCGTCGACACGGCAAAGTTCACCGGCCCACTCCAGAAGATCCCAGTC
GAGGACTTCGGAAGACCAAAGCCCAAGCAGACGGACTGCGCCCTGCGAAATCGCCACGACACGGTTGACTTCCGC
TTTGGTGACTTCGCCACCATCAAGGTTCCTTTCAGCGACTTTATTGCTTCTTATCGGGGACTCAAGGACTGCATC
TTTGGGGCACAGCTAACGGATGGAGCTCCGATTTTAGGCAGACCGTTCCTCCGTTCTGCCTATGTAGTCTTCGAC
CAGGACAACCGCAATGTTCATCTAGCCCAAAGTGCGGACTGCGGCTCCGCCCTTACCCCTATCACGAACGGGTCT
GATGCTGTTCCTGCCGTGAGCGGCCGATGCTAA
Transcript >Hirsu2|4597
ATGATCCCCCCAACGCCCGATAATTCCTCTCTTACGCAGGATATCGGCAAGCGTCAAGTCCACAGACCGTTAATA
CCCGATCGCAGTCGTTCGTTCTTCGCTATGGAGGTGCGAATCGGTGAACCGGCTCAGAGTGTCTTGGTGGACGTG
GATACCGGCTCCAAATATAACTGGGTGTTGGGACTCTCCGGCGACCCGGGACCCGACGCTCGCTTCTACTTTAAT
GTAAGCAAGAGCCCGACATTTCAGAAAGGCAACAATTCTGTGACATGGAAATACGGGAGCCAAAGAACAAAGTGG
GCCATGACAGCCGACGAAGGTAGGGACCTCTGGTCCCTGGGCGGCAAGACTCTGGGGTATATGCGCTTTGGCGTT
TCGTCAGGCGGACCTTTTCCTTTCAATAGGGGCATTTTAGGTCTCTCCTTTCCAGACCCGGCCTCCAAAACCGAC
TCCCTATTGGACAAGCTAGTTGTAGCAAGGATGACACAAAGCCGGGCTTATAGCATTGATATCGGTCCCACTTCA
AGGAACAAGGGATTCATCACCTTCGGTGGCGTCGACACGGCAAAGTTCACCGGCCCACTCCAGAAGATCCCAGTC
GAGGACTTCGGAAGACCAAAGCCCAAGCAGACGGACTGCGCCCTGCGAAATCGCCACGACACGGTTGACTTCCGC
TTTGGTGACTTCGCCACCATCAAGGTTCCTTTCAGCGACTTTATTGCTTCTTATCGGGGACTCAAGGACTGCATC
TTTGGGGCACAGCTAACGGATGGAGCTCCGATTTTAGGCAGACCGTTCCTCCGTTCTGCCTATGTAGTCTTCGAC
CAGGACAACCGCAATGTTCATCTAGCCCAAAGTGCGGACTGCGGCTCCGCCCTTACCCCTATCACGAACGGGTCT
GATGCTGTTCCTGCCGTGAGCGGCCGATGCTAA
Gene >Hirsu2|4597
ATGATCCCCCCAACGCCCGATAATTCCTCTCTTACGCAGGATATCGGCAAGCGTCAAGTCCACAGACCGTTAATA
CCCGATCGCAGTCGTTCGTTCTTCGCTATGGAGGTGCGAATCGGTGAACCGGCTCAGAGTGTCTTGGTGGACGTG
GATACCGGCTCCAAATATAACTGGGTGTTGGGACTCTCCGGCGACCCGGGACCCGACGCTCGCTTCTACTTTAAT
GTAAGCAAGAGCCCGACATTTCAGAAAGGCAACAATTCTGTGACATGGAAATACGGGAGCCAAAGAACAAAGTGG
GCCATGACAGCCGACGAAGGTAGGGACCTCTGGTCCCTGGGCGGTAGGTAACACGAAAATATGCTCCCCTCCGTG
GCCAGCTCGATACTGACGGTGCGCGTGACTAAAACTCTAGGCAAGACTCTGGGGTATATGCGCTTTGGCGTTTCG
TCAGGCGGACCTTTTCCTTTCAATAGGGGCATTTTAGGTCTCTCCTTTCCAGACCCGGCCTCCAAAACCGACTCC
CTATTGGACAAGCTAGTTGTAGCAAGGATGACACAAAGCCGGGCTTATAGCATTGATATCGGTCCCACTTCAAGG
AACAAGGGATTCATCACCTTCGGTGGCGTCGACACGGCAAAGTTCACCGGCCCACTCCAGAAGATCCCAGTCGAG
GACTTCGGAAGACCAAAGCCCAAGCAGTAAGTGTTTGAGCCCGCATGAAAACCATGACCTATGCAACCCATCAAT
TCGGTATTTCCCCCGCTCGTTCTAAACGTAGCCTTTCTGATAGCTATTACATCCTGCTCTCCCAACTTTCCTTCA
ATGGGACCCAGGGACGCACGTACGGGAAACCTGTTTTCGACACAGCCGCCTACCGGCGCCCAGTGCCCGGTGAGC
CTTATATAAGGCAGTATGGTCTCGCCGCGGTGATAGATACCGGCGCTCCGTTTGCCATTTCCCTCAATTCATCAT
CGACGAAATCTTGAATTCCTTTCCACCTGGAGAGCTTACACTACGCGACGGTTTTTACAGGACGGACTGCGCCCT
GCGAAATCGCCACGACACGGTTGACTTCCGCTTTGGTGACTTCGCCACCATCAAGGTTCCTTTCAGCGACTTTAT
TGCTTCTTATCGGGGACTCAAGGACTGCATCTTTGGGGCACAGCTAACGGATGGAGGTGAGTGCGACCTTGACGA
CTGGATGCTTCTTCCCTCGAAAGCACGTTGCGGGCGATCAGCAGAGCTAACGGTTGAAAAGCTCCGATTTTAGGC
AGACCGTTCCTCCGTTCTGCCTATGTAGTCTTCGACCAGGACAACCGCAATGTTCATCTAGCCCAAAGTGCGGAC
TGCGGCTCCGCCCTTACCCCTATCACGAACGGGTCTGATGCTGTTCCTGCCGTGAGCGGCCGATGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail