Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4596
Gene name
LocationContig_2329:342..2858
Strand+
Gene length (bp)2516
Transcript length (bp)2361
Coding sequence length (bp)2361
Protein length (aa) 787

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01171 ATP_bind_3 PP-loop family 5.0E-26 44 193
PF01171 ATP_bind_3 PP-loop family 2.5E-08 277 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10441|TILS_SCHPO Probable tRNA(Ile)-lysidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.08c PE=3 SV=1 15 204 3.0E-14
sp|Q839B3|TILS_ENTFA tRNA(Ile)-lysidine synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tilS PE=3 SV=1 41 189 6.0E-14
sp|B0UGN1|TILS_METS4 tRNA(Ile)-lysidine synthase OS=Methylobacterium sp. (strain 4-46) GN=tilS PE=3 SV=1 45 190 2.0E-12
sp|Q5GTD2|TILS_WOLTR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tilS PE=3 SV=1 35 247 2.0E-11
sp|Q73FR9|TILS_WOLPM tRNA(Ile)-lysidine synthase OS=Wolbachia pipientis wMel GN=tilS PE=3 SV=1 43 187 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10441|TILS_SCHPO Probable tRNA(Ile)-lysidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.08c PE=3 SV=1 15 204 3.0E-14
sp|Q839B3|TILS_ENTFA tRNA(Ile)-lysidine synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tilS PE=3 SV=1 41 189 6.0E-14
sp|B0UGN1|TILS_METS4 tRNA(Ile)-lysidine synthase OS=Methylobacterium sp. (strain 4-46) GN=tilS PE=3 SV=1 45 190 2.0E-12
sp|Q5GTD2|TILS_WOLTR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tilS PE=3 SV=1 35 247 2.0E-11
sp|Q73FR9|TILS_WOLPM tRNA(Ile)-lysidine synthase OS=Wolbachia pipientis wMel GN=tilS PE=3 SV=1 43 187 2.0E-11
sp|B3CLY6|TILS_WOLPP tRNA(Ile)-lysidine synthase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=tilS PE=3 SV=1 43 187 4.0E-11
sp|A5ERG8|TILS_BRASB tRNA(Ile)-lysidine synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tilS PE=3 SV=1 43 184 4.0E-11
sp|Q8YAC7|TILS_LISMO Bifunctional protein TilS/HprT OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tilS/hprT PE=3 SV=1 43 188 6.0E-11
sp|Q6HPV4|TILS_BACHK tRNA(Ile)-lysidine synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tilS PE=3 SV=1 20 187 1.0E-10
sp|Q81VX7|TILS_BACAN tRNA(Ile)-lysidine synthase OS=Bacillus anthracis GN=tilS PE=3 SV=1 20 187 1.0E-10
sp|C0R4S1|TILS_WOLWR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=tilS PE=3 SV=1 43 187 1.0E-10
sp|Q181G3|TILS_PEPD6 tRNA(Ile)-lysidine synthase OS=Peptoclostridium difficile (strain 630) GN=tilS PE=3 SV=1 43 192 3.0E-10
sp|Q5XEL7|TILS_STRP6 tRNA(Ile)-lysidine synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=tilS PE=3 SV=1 41 188 5.0E-10
sp|Q8P322|TILS_STRP8 tRNA(Ile)-lysidine synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=tilS PE=3 SV=1 41 188 5.0E-10
sp|P0DG01|TILS_STRPQ tRNA(Ile)-lysidine synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=tilS PE=3 SV=1 41 188 6.0E-10
sp|P0DG00|TILS_STRP3 tRNA(Ile)-lysidine synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=tilS PE=3 SV=1 41 188 6.0E-10
sp|Q9A201|TILS_STRP1 tRNA(Ile)-lysidine synthase OS=Streptococcus pyogenes serotype M1 GN=tilS PE=3 SV=1 41 188 6.0E-10
sp|Q9Z6R2|TILS_CHLPN tRNA(Ile)-lysidine synthase OS=Chlamydia pneumoniae GN=tilS PE=3 SV=1 45 189 6.0E-10
sp|Q724J4|TILS_LISMF Bifunctional protein TilS/HprT OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tilS/hprT PE=3 SV=1 43 188 1.0E-09
sp|Q5FQB6|TILS_GLUOX tRNA(Ile)-lysidine synthase OS=Gluconobacter oxydans (strain 621H) GN=tilS PE=3 SV=1 43 188 1.0E-09
sp|Q63HD6|TILS_BACCZ tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ZK / E33L) GN=tilS PE=3 SV=1 20 187 1.0E-09
sp|B8IP16|TILS_METNO tRNA(Ile)-lysidine synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tilS PE=3 SV=1 43 188 1.0E-09
sp|B1L8R5|TILS_THESQ tRNA(Ile)-lysidine synthase OS=Thermotoga sp. (strain RQ2) GN=tilS PE=3 SV=1 43 184 2.0E-09
sp|Q9WZ48|TILS_THEMA tRNA(Ile)-lysidine synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tilS PE=3 SV=1 43 184 2.0E-09
sp|B8ZJI9|TILS_STRPJ tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|C1CH91|TILS_STRZJ tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain JJA) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|B1I6Y3|TILS_STRPI tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|B2IQZ8|TILS_STRPS tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|B5E578|TILS_STRP4 tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|C1CN76|TILS_STRZP tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain P1031) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|C1CNP4|TILS_STRZT tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=tilS PE=3 SV=1 44 196 2.0E-09
sp|Q73FE5|TILS_BACC1 tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tilS PE=3 SV=1 20 187 3.0E-09
sp|Q6NAQ6|TILS_RHOPA tRNA(Ile)-lysidine synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tilS PE=3 SV=1 42 184 3.0E-09
sp|Q8KC15|TILS_CHLTE tRNA(Ile)-lysidine synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tilS PE=3 SV=1 38 188 3.0E-09
sp|Q9XBG6|TILS_BRADU tRNA(Ile)-lysidine synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tilS PE=3 SV=1 42 184 3.0E-09
sp|C1C992|TILS_STRP7 tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain 70585) GN=tilS PE=3 SV=1 44 196 5.0E-09
sp|Q97TC5|TILS_STRPN tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=tilS PE=3 SV=1 44 196 5.0E-09
sp|Q8DRP9|TILS_STRR6 tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=tilS PE=3 SV=1 44 196 5.0E-09
sp|Q04N53|TILS_STRP2 tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=tilS PE=3 SV=1 44 196 5.0E-09
sp|A8GY99|TILS_RICB8 tRNA(Ile)-lysidine synthase OS=Rickettsia bellii (strain OSU 85-389) GN=tilS PE=3 SV=1 43 184 6.0E-09
sp|Q1RGN9|TILS_RICBR tRNA(Ile)-lysidine synthase OS=Rickettsia bellii (strain RML369-C) GN=tilS PE=3 SV=1 43 184 6.0E-09
sp|Q68XR8|TILS_RICTY tRNA(Ile)-lysidine synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tilS PE=3 SV=1 43 205 8.0E-09
sp|Q72IF6|TILS_THET2 tRNA(Ile)-lysidine synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tilS PE=3 SV=1 33 178 8.0E-09
sp|Q5SI38|TILS_THET8 tRNA(Ile)-lysidine synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tilS PE=3 SV=1 33 178 8.0E-09
sp|Q2GC97|TILS_NOVAD tRNA(Ile)-lysidine synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tilS PE=3 SV=1 45 199 2.0E-08
sp|Q92JY3|TILS_RHIME tRNA(Ile)-lysidine synthase OS=Rhizobium meliloti (strain 1021) GN=tilS PE=3 SV=1 40 180 2.0E-08
sp|A9BJK2|TILS_PETMO tRNA(Ile)-lysidine synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tilS PE=3 SV=1 43 228 2.0E-08
sp|A8GLX9|TILS_RICAH tRNA(Ile)-lysidine synthase OS=Rickettsia akari (strain Hartford) GN=tilS PE=3 SV=1 43 237 2.0E-08
sp|Q822B9|TILS_CHLCV tRNA(Ile)-lysidine synthase OS=Chlamydophila caviae (strain GPIC) GN=tilS PE=3 SV=1 41 194 2.0E-08
sp|Q4UN67|TILS_RICFE tRNA(Ile)-lysidine synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tilS PE=3 SV=1 43 205 2.0E-08
sp|Q5LNU7|TILS_RUEPO tRNA(Ile)-lysidine synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tilS PE=3 SV=1 31 184 2.0E-08
sp|Q92JK0|TILS_RICCN tRNA(Ile)-lysidine synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tilS PE=3 SV=1 43 205 3.0E-08
sp|A3CJX7|TILS_STRSV tRNA(Ile)-lysidine synthase OS=Streptococcus sanguinis (strain SK36) GN=tilS PE=3 SV=1 41 188 3.0E-08
sp|Q5P9R1|TILS_ANAMM tRNA(Ile)-lysidine synthase OS=Anaplasma marginale (strain St. Maries) GN=tilS PE=3 SV=2 44 217 3.0E-08
sp|Q9ZGE2|TILS_HELMO tRNA(Ile)-lysidine synthase OS=Heliobacillus mobilis GN=tilS PE=3 SV=1 33 187 3.0E-08
sp|A8F0E8|TILS_RICM5 tRNA(Ile)-lysidine synthase OS=Rickettsia massiliae (strain Mtu5) GN=tilS PE=3 SV=1 43 205 3.0E-08
sp|C4K162|TILS_RICPU tRNA(Ile)-lysidine synthase OS=Rickettsia peacockii (strain Rustic) GN=tilS PE=3 SV=1 43 205 3.0E-08
sp|A8GQJ7|TILS_RICRS tRNA(Ile)-lysidine synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=tilS PE=3 SV=1 43 205 3.0E-08
sp|B0BVY4|TILS_RICRO tRNA(Ile)-lysidine synthase OS=Rickettsia rickettsii (strain Iowa) GN=tilS PE=3 SV=1 43 205 3.0E-08
sp|C3PM75|TILS_RICAE tRNA(Ile)-lysidine synthase OS=Rickettsia africae (strain ESF-5) GN=tilS PE=3 SV=1 43 205 3.0E-08
sp|Q0TMI0|TILS_CLOP1 tRNA(Ile)-lysidine synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=tilS PE=3 SV=2 45 192 4.0E-08
sp|Q8XHL1|TILS_CLOPE tRNA(Ile)-lysidine synthase OS=Clostridium perfringens (strain 13 / Type A) GN=tilS PE=3 SV=1 45 192 4.0E-08
sp|B2S2X0|TILS_TREPS tRNA(Ile)-lysidine synthase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=tilS PE=3 SV=1 31 190 5.0E-08
sp|O83388|TILS_TREPA tRNA(Ile)-lysidine synthase OS=Treponema pallidum (strain Nichols) GN=tilS PE=3 SV=1 31 190 5.0E-08
sp|Q9ZEA3|TILS_RICPR tRNA(Ile)-lysidine synthase OS=Rickettsia prowazekii (strain Madrid E) GN=tilS PE=3 SV=1 43 205 7.0E-08
sp|Q5NLX8|TILS_ZYMMO tRNA(Ile)-lysidine synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tilS PE=3 SV=1 43 188 7.0E-08
sp|Q97EB0|TILS_CLOAB tRNA(Ile)-lysidine synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tilS PE=3 SV=1 39 192 8.0E-08
sp|B3CUJ5|TILS_ORITI tRNA(Ile)-lysidine synthase OS=Orientia tsutsugamushi (strain Ikeda) GN=tilS PE=3 SV=1 43 184 8.0E-08
sp|A5CFP2|TILS_ORITB tRNA(Ile)-lysidine synthase OS=Orientia tsutsugamushi (strain Boryong) GN=tilS PE=3 SV=1 28 225 1.0E-07
sp|Q9PL79|TILS_CHLMU tRNA(Ile)-lysidine synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tilS PE=3 SV=1 39 187 1.0E-07
sp|B7GP48|TILS_BIFLS tRNA(Ile)-lysidine synthase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=tilS PE=3 SV=1 45 203 1.0E-07
sp|Q92F56|TILS_LISIN Bifunctional protein TilS/HprT OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tilS/hprT PE=3 SV=1 43 188 1.0E-07
sp|Q98F87|TILS_RHILO tRNA(Ile)-lysidine synthase OS=Rhizobium loti (strain MAFF303099) GN=tilS PE=3 SV=1 46 191 2.0E-07
sp|B3DR08|TILS_BIFLD tRNA(Ile)-lysidine synthase OS=Bifidobacterium longum (strain DJO10A) GN=tilS PE=3 SV=1 45 203 2.0E-07
sp|C0MAT4|TILS_STRE4 tRNA(Ile)-lysidine synthase OS=Streptococcus equi subsp. equi (strain 4047) GN=tilS PE=3 SV=1 41 191 2.0E-07
sp|Q81J84|TILS_BACCR tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tilS PE=3 SV=1 20 187 2.0E-07
sp|Q6F880|TILS_ACIAD tRNA(Ile)-lysidine synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tilS PE=3 SV=1 48 189 2.0E-07
sp|C0MC74|TILS_STRS7 tRNA(Ile)-lysidine synthase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=tilS PE=3 SV=1 41 191 3.0E-07
sp|B4U5H9|TILS_STREM tRNA(Ile)-lysidine synthase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tilS PE=3 SV=1 41 191 3.0E-07
sp|Q9RV23|TILS_DEIRA tRNA(Ile)-lysidine synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tilS PE=3 SV=2 41 187 4.0E-07
sp|Q3KKJ9|TILS_CHLTA tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tilS PE=3 SV=1 39 187 6.0E-07
sp|B0BAU8|TILS_CHLTB tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tilS PE=3 SV=1 39 187 7.0E-07
sp|B0B969|TILS_CHLT2 tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tilS PE=3 SV=1 39 187 7.0E-07
sp|O84847|TILS_CHLTR tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tilS PE=3 SV=1 39 187 8.0E-07
sp|Q8G3S4|TILS_BIFLO tRNA(Ile)-lysidine synthase OS=Bifidobacterium longum (strain NCC 2705) GN=tilS PE=3 SV=1 45 212 8.0E-07
sp|Q255L6|TILS_CHLFF tRNA(Ile)-lysidine synthase OS=Chlamydophila felis (strain Fe/C-56) GN=tilS PE=3 SV=1 41 188 8.0E-07
sp|Q74C65|TILS_GEOSL tRNA(Ile)-lysidine synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tilS PE=3 SV=1 32 188 8.0E-07
sp|Q3ZYX5|TILS_DEHMC tRNA(Ile)-lysidine synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=tilS PE=3 SV=1 43 188 9.0E-07
sp|Q5L5B2|TILS_CHLAB tRNA(Ile)-lysidine synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tilS PE=3 SV=1 41 194 1.0E-06
sp|Q83I94|TILS_TROW8 tRNA(Ile)-lysidine synthase OS=Tropheryma whipplei (strain TW08/27) GN=tilS PE=3 SV=1 45 195 2.0E-06
sp|P37563|TILS_BACSU tRNA(Ile)-lysidine synthase OS=Bacillus subtilis (strain 168) GN=tilS PE=1 SV=2 42 188 2.0E-06
sp|Q47KU2|TILS_THEFY tRNA(Ile)-lysidine synthase OS=Thermobifida fusca (strain YX) GN=tilS PE=3 SV=1 45 184 8.0E-06
sp|Q83MT2|TILS_TROWT tRNA(Ile)-lysidine synthase OS=Tropheryma whipplei (strain Twist) GN=tilS PE=3 SV=1 45 195 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4596
MSASNLLVRHGPKPITLLEFREAVEAVCRPHFRLGRRAQPRALALAISGGVDSMALAFLFSGLLKMRSGIEIAGI
PIIGAHSIVIDHQLRHGSAHEASCVVRELGRLGIGALVRPLSWSCVTERGSHPTQLSNLEGVARTMRYQMLGATC
RSLQANSLFFAHHRDDQYETILMRLMAGHGYRGLRGIQEANDIPECYELHGVSKSGSWNERPQQEPRQALKPPRT
EIQRRPILLGSGLQMGLRPGICDAPEVLSRQDNRSPDPHAQDLTPLECEDGGVVIYRPLLHFDKDRLIATCEANG
IRWFDDHTNLDPTLTTRNAIRHVTRTFQLPKALRKTAILELSDKAKRRTRYEEAEAKRLLVREAVVRSFDPNVGT
LAVEIPCFCPHRRLSRRLYASARAQMRKRHRRVVAAIMIRKLIDYVTPEVHLPPLSNLDNAVTLLFPELCYKPSG
QARKAFSVAGVLFDPVEDSASTNWILSRAPYPASRLFPERKLPGGVDGSPVSGNGAPAEPQTEHRWRGWETAKIW
DWRFWIQISTRVQTTLHVLPFLQQHAKAFRLALPREQRDKLERVLRRHARGKVRFSLPALYSSMTESGEGGVAQS
LTLLALPSLGIHVPGLERWVKYEVRDPVREVIAPRATQAIWHQTGRGRDGAVADAGCDDGLACEAEADDGCVRAA
KALPCCMYIRTGASSACRRSRWDEAGGLSLGLRFCVCEGSWASLSEAVVTGRDVALLANRATGAGPACISHACTV
SWRRSCLQAPKKSLKLDRTRQGPRMSHATLAESSNS*
Coding >Hirsu2|4596
ATGAGCGCATCCAACTTGCTTGTTCGCCATGGACCCAAGCCCATCACTCTGCTCGAGTTCCGCGAGGCCGTTGAG
GCCGTATGTCGGCCTCATTTTCGACTCGGCCGCCGTGCCCAGCCACGGGCTCTCGCTCTCGCCATCAGTGGAGGC
GTCGACTCCATGGCCTTGGCCTTCCTTTTTTCTGGCCTCCTGAAGATGCGTAGCGGCATCGAGATTGCTGGGATC
CCAATAATAGGTGCTCATAGCATCGTTATAGATCACCAGCTGCGCCATGGTAGCGCCCATGAAGCTTCTTGCGTT
GTCCGGGAGCTCGGAAGGCTGGGCATCGGGGCCCTCGTCAGGCCGTTGAGCTGGAGCTGTGTCACGGAAAGAGGC
TCACACCCGACGCAGCTGTCGAACCTCGAGGGCGTGGCACGCACGATGCGATACCAAATGCTCGGAGCCACTTGC
CGATCCCTGCAGGCCAACAGCTTGTTTTTTGCTCATCATCGCGACGACCAGTACGAGACAATTTTGATGCGCTTG
ATGGCCGGGCACGGCTATCGAGGCTTGCGAGGAATTCAAGAGGCAAACGACATTCCCGAATGCTACGAGCTGCAC
GGTGTCTCCAAGAGCGGTTCTTGGAACGAGAGGCCGCAGCAAGAGCCACGTCAGGCTCTCAAGCCGCCAAGAACT
GAAATCCAGCGGAGACCGATCTTGCTCGGAAGCGGCCTCCAGATGGGCTTGCGCCCCGGAATATGTGACGCACCT
GAAGTGCTATCGAGGCAAGATAACCGCAGCCCCGACCCCCATGCGCAAGACTTGACGCCGCTGGAATGCGAAGAC
GGTGGCGTCGTCATCTATCGTCCTCTACTGCATTTTGACAAGGACAGGCTCATCGCTACTTGTGAGGCCAATGGT
ATTCGCTGGTTTGATGACCACACCAACCTGGACCCGACTCTCACGACGCGCAACGCCATTCGCCACGTCACAAGA
ACCTTCCAGCTGCCGAAGGCTTTGCGAAAGACCGCTATCCTGGAATTGTCCGACAAGGCCAAGCGAAGGACGAGG
TATGAGGAAGCTGAGGCCAAAAGGCTCCTCGTTCGCGAAGCCGTTGTCCGGTCCTTCGACCCCAACGTGGGCACG
CTTGCCGTCGAGATTCCTTGCTTCTGCCCGCATCGGCGGCTGTCGAGACGGCTGTACGCCTCAGCAAGAGCACAA
ATGCGAAAGCGTCACCGAAGGGTTGTCGCTGCAATCATGATCCGCAAGCTTATTGACTATGTCACACCCGAAGTC
CACTTGCCGCCACTCTCCAATCTCGACAATGCAGTAACCTTGCTCTTCCCAGAGCTCTGCTACAAGCCGTCTGGT
CAGGCACGGAAAGCCTTCTCTGTGGCCGGGGTGCTGTTCGATCCTGTCGAGGATTCGGCATCGACCAACTGGATT
CTCTCACGAGCCCCCTACCCAGCCTCTCGACTCTTTCCCGAGCGAAAATTACCTGGCGGCGTGGATGGCAGCCCT
GTATCGGGGAATGGTGCACCCGCAGAGCCTCAGACAGAACATCGCTGGCGAGGATGGGAAACGGCCAAGATATGG
GACTGGCGGTTCTGGATACAGATCAGCACGCGTGTACAGACGACCCTCCACGTCCTGCCATTCTTGCAGCAGCAC
GCCAAGGCCTTTCGTTTGGCGCTGCCCCGAGAGCAACGAGACAAACTCGAGCGGGTGCTCAGGCGCCATGCTCGA
GGCAAGGTGCGCTTCTCGCTGCCCGCACTCTACAGCAGCATGACAGAGAGTGGTGAGGGTGGAGTGGCACAATCT
TTGACATTGCTTGCCTTGCCAAGCCTCGGGATCCATGTCCCAGGTCTGGAGCGTTGGGTCAAGTACGAGGTGAGA
GACCCAGTGCGAGAAGTCATCGCCCCTCGAGCTACACAAGCTATCTGGCATCAGACGGGCCGCGGACGAGATGGC
GCCGTGGCAGACGCTGGGTGCGACGACGGGCTTGCGTGCGAAGCAGAAGCTGACGACGGCTGCGTCAGGGCTGCG
AAGGCACTTCCATGCTGTATGTACATACGTACAGGCGCCTCGTCCGCGTGTCGCAGATCGCGGTGGGACGAGGCT
GGCGGCCTGTCCCTCGGCCTGCGGTTCTGTGTATGTGAGGGCAGCTGGGCTAGCCTGAGTGAGGCGGTCGTGACG
GGTAGGGATGTCGCCCTGCTGGCGAATCGTGCCACAGGAGCTGGACCTGCGTGCATTTCGCACGCATGTACAGTA
AGCTGGCGGCGCTCGTGTCTTCAGGCGCCCAAAAAGAGTCTGAAGCTGGACCGAACTCGCCAGGGTCCCCGAATG
TCGCATGCGACGCTGGCCGAATCGTCCAATTCATAG
Transcript >Hirsu2|4596
ATGAGCGCATCCAACTTGCTTGTTCGCCATGGACCCAAGCCCATCACTCTGCTCGAGTTCCGCGAGGCCGTTGAG
GCCGTATGTCGGCCTCATTTTCGACTCGGCCGCCGTGCCCAGCCACGGGCTCTCGCTCTCGCCATCAGTGGAGGC
GTCGACTCCATGGCCTTGGCCTTCCTTTTTTCTGGCCTCCTGAAGATGCGTAGCGGCATCGAGATTGCTGGGATC
CCAATAATAGGTGCTCATAGCATCGTTATAGATCACCAGCTGCGCCATGGTAGCGCCCATGAAGCTTCTTGCGTT
GTCCGGGAGCTCGGAAGGCTGGGCATCGGGGCCCTCGTCAGGCCGTTGAGCTGGAGCTGTGTCACGGAAAGAGGC
TCACACCCGACGCAGCTGTCGAACCTCGAGGGCGTGGCACGCACGATGCGATACCAAATGCTCGGAGCCACTTGC
CGATCCCTGCAGGCCAACAGCTTGTTTTTTGCTCATCATCGCGACGACCAGTACGAGACAATTTTGATGCGCTTG
ATGGCCGGGCACGGCTATCGAGGCTTGCGAGGAATTCAAGAGGCAAACGACATTCCCGAATGCTACGAGCTGCAC
GGTGTCTCCAAGAGCGGTTCTTGGAACGAGAGGCCGCAGCAAGAGCCACGTCAGGCTCTCAAGCCGCCAAGAACT
GAAATCCAGCGGAGACCGATCTTGCTCGGAAGCGGCCTCCAGATGGGCTTGCGCCCCGGAATATGTGACGCACCT
GAAGTGCTATCGAGGCAAGATAACCGCAGCCCCGACCCCCATGCGCAAGACTTGACGCCGCTGGAATGCGAAGAC
GGTGGCGTCGTCATCTATCGTCCTCTACTGCATTTTGACAAGGACAGGCTCATCGCTACTTGTGAGGCCAATGGT
ATTCGCTGGTTTGATGACCACACCAACCTGGACCCGACTCTCACGACGCGCAACGCCATTCGCCACGTCACAAGA
ACCTTCCAGCTGCCGAAGGCTTTGCGAAAGACCGCTATCCTGGAATTGTCCGACAAGGCCAAGCGAAGGACGAGG
TATGAGGAAGCTGAGGCCAAAAGGCTCCTCGTTCGCGAAGCCGTTGTCCGGTCCTTCGACCCCAACGTGGGCACG
CTTGCCGTCGAGATTCCTTGCTTCTGCCCGCATCGGCGGCTGTCGAGACGGCTGTACGCCTCAGCAAGAGCACAA
ATGCGAAAGCGTCACCGAAGGGTTGTCGCTGCAATCATGATCCGCAAGCTTATTGACTATGTCACACCCGAAGTC
CACTTGCCGCCACTCTCCAATCTCGACAATGCAGTAACCTTGCTCTTCCCAGAGCTCTGCTACAAGCCGTCTGGT
CAGGCACGGAAAGCCTTCTCTGTGGCCGGGGTGCTGTTCGATCCTGTCGAGGATTCGGCATCGACCAACTGGATT
CTCTCACGAGCCCCCTACCCAGCCTCTCGACTCTTTCCCGAGCGAAAATTACCTGGCGGCGTGGATGGCAGCCCT
GTATCGGGGAATGGTGCACCCGCAGAGCCTCAGACAGAACATCGCTGGCGAGGATGGGAAACGGCCAAGATATGG
GACTGGCGGTTCTGGATACAGATCAGCACGCGTGTACAGACGACCCTCCACGTCCTGCCATTCTTGCAGCAGCAC
GCCAAGGCCTTTCGTTTGGCGCTGCCCCGAGAGCAACGAGACAAACTCGAGCGGGTGCTCAGGCGCCATGCTCGA
GGCAAGGTGCGCTTCTCGCTGCCCGCACTCTACAGCAGCATGACAGAGAGTGGTGAGGGTGGAGTGGCACAATCT
TTGACATTGCTTGCCTTGCCAAGCCTCGGGATCCATGTCCCAGGTCTGGAGCGTTGGGTCAAGTACGAGGTGAGA
GACCCAGTGCGAGAAGTCATCGCCCCTCGAGCTACACAAGCTATCTGGCATCAGACGGGCCGCGGACGAGATGGC
GCCGTGGCAGACGCTGGGTGCGACGACGGGCTTGCGTGCGAAGCAGAAGCTGACGACGGCTGCGTCAGGGCTGCG
AAGGCACTTCCATGCTGTATGTACATACGTACAGGCGCCTCGTCCGCGTGTCGCAGATCGCGGTGGGACGAGGCT
GGCGGCCTGTCCCTCGGCCTGCGGTTCTGTGTATGTGAGGGCAGCTGGGCTAGCCTGAGTGAGGCGGTCGTGACG
GGTAGGGATGTCGCCCTGCTGGCGAATCGTGCCACAGGAGCTGGACCTGCGTGCATTTCGCACGCATGTACAGTA
AGCTGGCGGCGCTCGTGTCTTCAGGCGCCCAAAAAGAGTCTGAAGCTGGACCGAACTCGCCAGGGTCCCCGAATG
TCGCATGCGACGCTGGCCGAATCGTCCAATTCATAG
Gene >Hirsu2|4596
ATGAGCGCATCCAACTTGCTTGTTCGCCATGGACCCAAGCCCATCACTCTGCTCGAGTTCCGCGAGGCCGTTGAG
GCCGTATGTCGGCCTCATTTTCGACTCGGCCGCCGTGCCCAGCCACGGGCTCTCGGTAGGACCCTCGCTTGCCCC
CTCGCCTTACCTCTTTCATCCCTTTCTCCCAGCTCGCTCTCGGCTCCCCAAGATGACTGCTGCAAAAAGAAAGGC
CTGCTGATTGCTTGAGCCAGCTCTCGCCATCAGTGGAGGCGTCGACTCCATGGCCTTGGCCTTCCTTTTTTCTGG
CCTCCTGAAGATGCGTAGCGGCATCGAGATTGCTGGGATCCCAATAATAGGTGCTCATAGCATCGTTATAGATCA
CCAGCTGCGCCATGGTAGCGCCCATGAAGCTTCTTGCGTTGTCCGGGAGCTCGGAAGGCTGGGCATCGGGGCCCT
CGTCAGGCCGTTGAGCTGGAGCTGTGTCACGGAAAGAGGCTCACACCCGACGCAGCTGTCGAACCTCGAGGGCGT
GGCACGCACGATGCGATACCAAATGCTCGGAGCCACTTGCCGATCCCTGCAGGCCAACAGCTTGTTTTTTGCTCA
TCATCGCGACGACCAGTACGAGACAATTTTGATGCGCTTGATGGCCGGGCACGGCTATCGAGGCTTGCGAGGAAT
TCAAGAGGCAAACGACATTCCCGAATGCTACGAGCTGCACGGTGTCTCCAAGAGCGGTTCTTGGAACGAGAGGCC
GCAGCAAGAGCCACGTCAGGCTCTCAAGCCGCCAAGAACTGAAATCCAGCGGAGACCGATCTTGCTCGGAAGCGG
CCTCCAGATGGGCTTGCGCCCCGGAATATGTGACGCACCTGAAGTGCTATCGAGGCAAGATAACCGCAGCCCCGA
CCCCCATGCGCAAGACTTGACGCCGCTGGAATGCGAAGACGGTGGCGTCGTCATCTATCGTCCTCTACTGCATTT
TGACAAGGACAGGCTCATCGCTACTTGTGAGGCCAATGGTATTCGCTGGTTTGATGACCACACCAACCTGGACCC
GACTCTCACGACGCGCAACGCCATTCGCCACGTCACAAGAACCTTCCAGCTGCCGAAGGCTTTGCGAAAGACCGC
TATCCTGGAATTGTCCGACAAGGCCAAGCGAAGGACGAGGTATGAGGAAGCTGAGGCCAAAAGGCTCCTCGTTCG
CGAAGCCGTTGTCCGGTCCTTCGACCCCAACGTGGGCACGCTTGCCGTCGAGATTCCTTGCTTCTGCCCGCATCG
GCGGCTGTCGAGACGGCTGTACGCCTCAGCAAGAGCACAAATGCGAAAGCGTCACCGAAGGGTTGTCGCTGCAAT
CATGATCCGCAAGCTTATTGACTATGTCACACCCGAAGTCCACTTGCCGCCACTCTCCAATCTCGACAATGCAGT
AACCTTGCTCTTCCCAGAGCTCTGCTACAAGCCGTCTGGTCAGGCACGGAAAGCCTTCTCTGTGGCCGGGGTGCT
GTTCGATCCTGTCGAGGATTCGGCATCGACCAACTGGATTCTCTCACGAGCCCCCTACCCAGCCTCTCGACTCTT
TCCCGAGCGAAAATTACCTGGCGGCGTGGATGGCAGCCCTGTATCGGGGAATGGTGCACCCGCAGAGCCTCAGAC
AGAACATCGCTGGCGAGGATGGGAAACGGCCAAGATATGGGACTGGCGGTTCTGGATACAGATCAGCACGCGTGT
ACAGACGACCCTCCACGTCCTGCCATTCTTGCAGCAGCACGCCAAGGCCTTTCGTTTGGCGCTGCCCCGAGAGCA
ACGAGACAAACTCGAGCGGGTGCTCAGGCGCCATGCTCGAGGCAAGGTGCGCTTCTCGCTGCCCGCACTCTACAG
CAGCATGACAGAGAGTGGTGAGGGTGGAGTGGCACAATCTTTGACATTGCTTGCCTTGCCAAGCCTCGGGATCCA
TGTCCCAGGTCTGGAGCGTTGGGTCAAGTACGAGGTGAGGTATAAAAAAATTGACGCGACGCTGCTGGGCCTCGC
GAAGAGACCCAGTGCGAGAAGTCATCGCCCCTCGAGCTACACAAGCTATCTGGCATCAGACGGGCCGCGGACGAG
ATGGCGCCGTGGCAGACGCTGGGTGCGACGACGGGCTTGCGTGCGAAGCAGAAGCTGACGACGGCTGCGTCAGGG
CTGCGAAGGCACTTCCATGCTGTATGTACATACGTACAGGCGCCTCGTCCGCGTGTCGCAGATCGCGGTGGGACG
AGGCTGGCGGCCTGTCCCTCGGCCTGCGGTTCTGTGTATGTGAGGGCAGCTGGGCTAGCCTGAGTGAGGCGGTCG
TGACGGGTAGGGATGTCGCCCTGCTGGCGAATCGTGCCACAGGAGCTGGACCTGCGTGCATTTCGCACGCATGTA
CAGTAAGCTGGCGGCGCTCGTGTCTTCAGGCGCCCAAAAAGAGTCTGAAGCTGGACCGAACTCGCCAGGGTCCCC
GAATGTCGCATGCGACGCTGGCCGAATCGTCCAATTCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail